Align BadK (characterized)
to candidate H281DRAFT_05722 H281DRAFT_05722 short chain enoyl-CoA hydratase /Enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Burk376:H281DRAFT_05722 Length = 263 Score = 154 bits (390), Expect = 1e-42 Identities = 97/258 (37%), Positives = 140/258 (54%), Gaps = 13/258 (5%) Query: 9 ETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIA 68 + RV ITLNRPD LN+ A+ L AL + G A+V+ G R F AG D+A Sbjct: 11 DAASRVATITLNRPDKLNSFTRAMHQELNAALNEVETS-GARALVLTGAGRGFCAGQDLA 69 Query: 69 SMA--------AWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIV 120 + D++ + I R ++ + PV+AAV G A G G LALACDIV Sbjct: 70 DLDFTPGAMTDLGELIDLHFNPLIRR----LQALPLPVIAAVNGTAAGAGANLALACDIV 125 Query: 121 IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV 180 +A RSA F +K+GL+P +GGT LP+ +G A+A+ + ++ L+AE+A+ +GL+ + Sbjct: 126 LAARSASFIQAFVKIGLVPDSGGTWFLPQRVGMARALGLAITGDKLSAEKAESWGLIWQT 185 Query: 181 VDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADA 240 VDD L LA +A A+ A+K+++ TL + + ER AS D Sbjct: 186 VDDQELAATAAKLAAQLAQQPTRAIAAIKQAMRAGATQTLDQQLDLERDLQRELGASHDY 245 Query: 241 REGIQAFLEKRAPCFSHR 258 EG+QAF+EKRAP F R Sbjct: 246 AEGVQAFVEKRAPRFEGR 263 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 263 Length adjustment: 25 Effective length of query: 233 Effective length of database: 238 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory