Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate H281DRAFT_01137 H281DRAFT_01137 2-oxoglutaroyl-CoA hydrolase
Query= BRENDA::D3RXI0 (252 letters) >FitnessBrowser__Burk376:H281DRAFT_01137 Length = 268 Score = 118 bits (296), Expect = 1e-31 Identities = 82/250 (32%), Positives = 129/250 (51%), Gaps = 6/250 (2%) Query: 6 IKVEKDERVARIKIANPPVNVLDM---ETMKEIISAIDEVEGVDVIVFSGEGKSFSAGAE 62 I+++ + A I + PP NV+ M + ++ A+DE E V VIV +G+ FS+G + Sbjct: 20 IEIDAERERADIVLHRPPFNVISMHARDQLRAAFEALDEDERVRVIVVRAKGEHFSSGGD 79 Query: 63 IKEHFPDKAPEMIRWFTQLIDKVLRCKAITVAAVKGFALGGGFELAIACDFVLASKNAKL 122 IK F + +PE + I RC +AA +GF G GFEL++ACDF +A+ Sbjct: 80 IKG-FLEASPEHVSKLAWNIAAPARCSKPVIAANRGFCFGVGFELSLACDFRIATDTTFY 138 Query: 123 GVPEITLAHYP-PVAIALLPRMIGWKNAYELILTGEAITAERAFEIGLVNKVFEDENFEE 181 +PE L P A L +M+G ++++ I ++A+E G+ + D E Sbjct: 139 ALPEQKLGQIPGSGGSARLQQMVGIGRTKDIVMRSRRIPGKQAYEWGIAVECVADAQLEA 198 Query: 182 SVNDFVNSLLEKSSVALRLTKKALLFSTEKEYLSLFDVINDVYLSQLVKSEDAVEGLKAF 241 + + V+ L S +A R KK LL TE LS+ + S+L S+D EG++AF Sbjct: 199 ATDALVDELRAFSPLAQRTAKK-LLNDTEDAPLSIAIELEGHCYSRLRTSDDFREGVEAF 257 Query: 242 LEKRKPEWKG 251 KRKP ++G Sbjct: 258 HGKRKPVFRG 267 Lambda K H 0.318 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 268 Length adjustment: 24 Effective length of query: 228 Effective length of database: 244 Effective search space: 55632 Effective search space used: 55632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory