GapMind for catabolism of small carbon sources

 

Aligments for a candidate for maiA in Paraburkholderia bryophila 376MFSha3.1

Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate H281DRAFT_01970 H281DRAFT_01970 maleylacetoacetate isomerase (EC 5.2.1.2)

Query= reanno::MR1:200836
         (216 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_01970 H281DRAFT_01970
           maleylacetoacetate isomerase (EC 5.2.1.2)
          Length = 214

 Score =  245 bits (625), Expect = 5e-70
 Identities = 125/218 (57%), Positives = 157/218 (72%), Gaps = 8/218 (3%)

Query: 1   MILYGYWRSSAAYRVRIALNLKGVSAEQLSVHLVRDGGEQHKADYIALNPQELVPTLVVD 60
           M LY Y+RSSA+YRVRIALN+K +  E + VHLVRDGGEQ K +Y A+N   +VPTL+  
Sbjct: 1   MKLYSYFRSSASYRVRIALNVKNLPYEYVPVHLVRDGGEQLKPEYRAVNVDGIVPTLI-- 58

Query: 61  DEQDG-DALTQSLAIIEYLDELYPKTPLLPASALERAHVRAMALTIACEIHPLNNLRVLQ 119
              DG + + QSLAIIEYL+E +P+ PLLP +  +RA+VR++AL +ACEIHPLNNLRVL+
Sbjct: 59  ---DGHEVMPQSLAIIEYLEETHPEPPLLPKAPADRAYVRSLALQVACEIHPLNNLRVLK 115

Query: 120 YLTQKLTVNEEAKSAWYHHWVATGFTALETQLVR--HSGRYCFGDKVTIADLCLVPQVYN 177
           YL   L V  +AK AWY HWV TGF  LE  L     +G+ CFGD+ T+AD CL+PQV+N
Sbjct: 116 YLKHTLRVENDAKDAWYRHWVDTGFATLEAHLASDGRTGKLCFGDEPTLADACLIPQVFN 175

Query: 178 AQRFNVDLTPYPNIMRVWAECNQLPAFADAAPERQADA 215
           AQRFNVD + YP I R++    Q+ AFA AAP  Q DA
Sbjct: 176 AQRFNVDTSKYPTIQRIYDHAMQIDAFARAAPGVQPDA 213


Lambda     K      H
   0.321    0.134    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 178
Number of extensions: 7
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 216
Length of database: 214
Length adjustment: 22
Effective length of query: 194
Effective length of database: 192
Effective search space:    37248
Effective search space used:    37248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)

Align candidate H281DRAFT_01970 H281DRAFT_01970 (maleylacetoacetate isomerase (EC 5.2.1.2))
to HMM TIGR01262 (maiA: maleylacetoacetate isomerase (EC 5.2.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01262.hmm
# target sequence database:        /tmp/gapView.18109.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01262  [M=211]
Accession:   TIGR01262
Description: maiA: maleylacetoacetate isomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
    7.5e-91  289.5   0.0    8.4e-91  289.3   0.0    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_01970  H281DRAFT_01970 maleylacetoaceta


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_01970  H281DRAFT_01970 maleylacetoacetate isomerase (EC 5.2.1.2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  289.3   0.0   8.4e-91   8.4e-91       1     210 [.       2     213 ..       2     214 .] 0.99

  Alignments for each domain:
  == domain 1  score: 289.3 bits;  conditional E-value: 8.4e-91
                                    TIGR01262   1 klYsyfrSsasyRvRiaLaLkgidyesvpvnLlkd.GeqkkeefkalNPqelvPtLkidegevltq 65 
                                                  klYsyfrSsasyRvRiaL++k++ ye+vpv+L++d Geq k+e++a+N  + vPtL++++ ev+ q
  lcl|FitnessBrowser__Burk376:H281DRAFT_01970   2 KLYSYFRSSASYRVRIALNVKNLPYEYVPVHLVRDgGEQLKPEYRAVNVDGIVPTLIDGH-EVMPQ 66 
                                                  69*********************************************************6.***** PP

                                    TIGR01262  66 SlAiieyLeetypepaLlpkdpakrarvralalliacdihPlqNlrvlqlleeklgvdeeekkewl 131
                                                  SlAiieyLeet+pep+Llpk pa+ra vr+lal +ac+ihPl+Nlrvl++l+++l v++++k++w+
  lcl|FitnessBrowser__Burk376:H281DRAFT_01970  67 SLAIIEYLEETHPEPPLLPKAPADRAYVRSLALQVACEIHPLNNLRVLKYLKHTLRVENDAKDAWY 132
                                                  ****************************************************************** PP

                                    TIGR01262 132 khwiekGlaalEellk..ekagafcvGdevtladvcLvpqvynAerfevdlaqyPtlkrieealae 195
                                                  +hw+++G+a+lE++l+   ++g+ c+Gde+tlad cL+pqv nA+rf+vd ++yPt++ri +++ +
  lcl|FitnessBrowser__Burk376:H281DRAFT_01970 133 RHWVDTGFATLEAHLAsdGRTGKLCFGDEPTLADACLIPQVFNAQRFNVDTSKYPTIQRIYDHAMQ 198
                                                  ***************98889********************************************** PP

                                    TIGR01262 196 lpafqeahpenqpdt 210
                                                  ++af++a+p  qpd+
  lcl|FitnessBrowser__Burk376:H281DRAFT_01970 199 IDAFARAAPGVQPDA 213
                                                  **************7 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (214 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 6.43
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory