Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate H281DRAFT_02741 H281DRAFT_02741 Enoyl-CoA hydratase/carnithine racemase
Query= BRENDA::Q5SLK3 (254 letters) >FitnessBrowser__Burk376:H281DRAFT_02741 Length = 260 Score = 163 bits (413), Expect = 3e-45 Identities = 99/245 (40%), Positives = 140/245 (57%), Gaps = 8/245 (3%) Query: 10 VLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDR 69 V + LNRPEK NAIT E+ L AAL+ DR+VRA++LTG G+ F AG D++ R Sbjct: 14 VATIALNRPEKRNAITNEMRAELIAALESVSRDRDVRAVVLTGNGKGFCAGGDVSGMAQR 73 Query: 70 K--PDYEAHLRRYNR------VVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVG 121 P E ++R V L + KP + AVNG AAG G +AL D LA+ Sbjct: 74 MEAPAGEVAFNGWSRQQIVHHTVNLLYSMPKPTIAAVNGAAAGLGADMALSCDFILASHE 133 Query: 122 ASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEK 181 ASFT +++R GL+PD G + LPR VGLA+A+EL+ ++ A+EAL LG+ R+ + Sbjct: 134 ASFTWSYIRRGLIPDGGGMYFLPRRVGLARAKELIFSGRKVDAKEALELGIADRLSAPDS 193 Query: 182 LMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVR 241 L+ +A + A EL+QG A AL K +L ++Y LS + A + Q + +H + V Sbjct: 194 LIADAHAWAVELSQGSATALALGKTILNQSYELSAHQVFAQGSQAQAVCYTSSEHRDSVL 253 Query: 242 AFREK 246 AF K Sbjct: 254 AFLNK 258 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 260 Length adjustment: 24 Effective length of query: 230 Effective length of database: 236 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory