GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pad-dh in Paraburkholderia bryophila 376MFSha3.1

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate H281DRAFT_00993 H281DRAFT_00993 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase

Query= BRENDA::P05091
         (517 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_00993 H281DRAFT_00993
           gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
          Length = 497

 Score =  379 bits (974), Expect = e-109
 Identities = 201/477 (42%), Positives = 297/477 (62%), Gaps = 5/477 (1%)

Query: 40  FINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDAS 99
           FI  +  +A S +TF T+NPSTG+V+  +A+ D +DVD+AV AAR AF+ G  W +   +
Sbjct: 21  FIAGQRANAASNETFATLNPSTGKVLADIAKCDTKDVDRAVAAAREAFESGV-WSKAAPA 79

Query: 100 HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGK 159
            R  +L RLA LI+ +   LA LE L+ GKP      +D+     C+R++A   DK +  
Sbjct: 80  QRKAVLQRLAQLIDDNAEELALLEALEAGKPISECLGLDIPESAACIRWHAEVTDKRYDA 139

Query: 160 TIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL 219
             P      S    EP+GV G ++PWNFP LM AWK+GPAL+ GN V++K AEQT L+ L
Sbjct: 140 LSPSGASVVSMITREPIGVVGAVLPWNFPALMLAWKIGPALSVGNSVIVKPAEQTSLSTL 199

Query: 220 YVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNL 279
            +A+L  EAG P GV+N+V GFG +AG A+  H DVD VAFTGSTE G+     +  +NL
Sbjct: 200 RIADLALEAGLPAGVLNVVTGFGESAGQALGRHADVDLVAFTGSTETGKRFLRYSADTNL 259

Query: 280 KRVTLELGGKSPNIIMSD-ADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVER 338
           KRV LE GGK+P +++ D A++D   EQA  A F+N G+ C AGSR  V   +    +E+
Sbjct: 260 KRVVLECGGKNPQVVLPDVANLDAVAEQAVAAAFWNMGENCSAGSRILVPSSLKASLLEK 319

Query: 339 SVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAA--DRGY 396
            +A  +    G+P D   + G  ++E  F+K+L +I   + EGA+L+CGG        G+
Sbjct: 320 VLAVLEVWKTGDPLDPDVKLGSLIEEMHFEKVLAHIEKARAEGARLVCGGKATRTDSGGW 379

Query: 397 FIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKA 456
           F++PT+F +V   M IA++E+FGPV+  +++  I+E V  AN++ YGLAA+++T +++ A
Sbjct: 380 FVEPTIFDNVTPQMRIARDEVFGPVVCFIEYADIDEAVHIANDTCYGLAASLWTDNVNHA 439

Query: 457 NYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSG-SGRELGEYGLQAYTEVKTVTVKV 512
           + ++  ++AGTV VNC+      +PFGG+K SG  GR+   Y    Y E+KT  +K+
Sbjct: 440 HKIAARIRAGTVTVNCFGEGDLSTPFGGFKQSGFGGRDKSVYAHDQYCELKTTWLKL 496


Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 627
Number of extensions: 28
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 517
Length of database: 497
Length adjustment: 34
Effective length of query: 483
Effective length of database: 463
Effective search space:   223629
Effective search space used:   223629
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory