Align pimeloyl-CoA dehydrogenase large subunit (EC 1.3.1.62) (characterized)
to candidate H281DRAFT_01180 H281DRAFT_01180 acyl-CoA dehydrogenase
Query= metacyc::MONOMER-20676 (396 letters) >FitnessBrowser__Burk376:H281DRAFT_01180 Length = 762 Score = 258 bits (658), Expect = 5e-73 Identities = 151/391 (38%), Positives = 218/391 (55%), Gaps = 13/391 (3%) Query: 11 AFRDEVRQFFKDNVPAKTRQKLIEGRHNTKEEMVEWYRILNKKG--WAVTHWPKEYGGTG 68 AFR ++ + + NVPA R R ++ + + + K G ++ W KE+GG G Sbjct: 15 AFRKKIADYIEANVPADVRAATRANRKLGRDLLSRYTAAMAKGGLGYSAPGWTKEFGGPG 74 Query: 69 WSSVQHYIFNEELQAAPAPQPLAFGVSMVGPVIYTFGSEEQKKRFLPRIANVDDWWCQGF 128 W +Q IF E A PQ G+ +GPVI FG++EQK RFLP I + +WWCQG+ Sbjct: 75 WDVMQRLIFEEVTAAMDCPQLYHHGIGHIGPVIQAFGTDEQKARFLPPIIDGTEWWCQGY 134 Query: 129 SEPGSGSDLASLKTKA--EKKGDKWIINGQKTWTTLAQHADWIFCLCRTDPAAKKQEGIS 186 SEPG+GSDLASLKT A + G+ +I+NGQK WT+ AQ AD ++ L RT K+QEGI+ Sbjct: 135 SEPGAGSDLASLKTSAVLDGTGEHYIVNGQKIWTSHAQEADIMYTLVRTSNEGKRQEGIT 194 Query: 187 FILVDMKTKGITVRPIQTIDGGHEVNEVFFDDVEVPLENLVGQENKGWDYAKFLLGNERT 246 +L+ M T GI VRPI+TID H VNEVF DV+VP+ N +G E +GW Y KFLL ER Sbjct: 195 LLLIPMNTPGIEVRPIRTIDQWHHVNEVFLKDVKVPVSNRIGAEGQGWSYGKFLLDRERL 254 Query: 247 GIARVGMSKERIRRIKQLAAQ--VESGGKPVIEDPKFRDKLAAVEIELKALELTQLRVVA 304 A + ++++ QL E G P + K D+L +E+E A ++ + A Sbjct: 255 SPALMPRLLRHVQQVTQLVQDKIKEKGASPSL--LKALDRL--LEVEAGAYGTREILLSA 310 Query: 305 DEGKHGKGKPNPASSVLKIKGSEIQQATTELLMEVIGP-FAAPYDVHGDDDSNETMDWTA 363 + SS LK+ S+ Q T + M+V+GP +AA + S++ ++ Sbjct: 311 IREDMAGTLESSKSSALKMACSKQSQEVTSIAMDVLGPEYAA--RLQPLTTSDDELNLER 368 Query: 364 QIAPGYFNNRKVSIYGGSNEIQRNIICKAVL 394 Y R ++ GGS E+Q+NII K ++ Sbjct: 369 NFVHTYLFYRSRTLAGGSTEVQKNIIAKTIM 399 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 674 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 762 Length adjustment: 36 Effective length of query: 360 Effective length of database: 726 Effective search space: 261360 Effective search space used: 261360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory