Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate H281DRAFT_00093 H281DRAFT_00093 amino acid/amide ABC transporter membrane protein 1, HAAT family
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__Burk376:H281DRAFT_00093 Length = 551 Score = 141 bits (355), Expect = 4e-38 Identities = 96/292 (32%), Positives = 155/292 (53%), Gaps = 15/292 (5%) Query: 8 LINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALIT---FLAIGSLGITW 64 L GLSLG++ L A+G + YG+IG+IN AHGE MIGA+ + F G W Sbjct: 258 LFAGLSLGSVLLLAALGLAITYGLIGVINMAHGEFLMIGAYATYVVQNLFQRFAPGGFDW 317 Query: 65 VPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQILQGA 124 P LV + AS + A+ G +ER+ + L P L L++ G+S+ L ++L GA Sbjct: 318 YP---LVAVPASFVAAALVGIVIERLVLKHLYGRP-LETLLTTFGISLILIQATRMLFGA 373 Query: 125 RSKPLQPILP----GNLTLMDGAVSVSYVRLATIVITIALMYGFTQLITRTSLGRAQRAC 180 ++ +Q + P G +T+M + + Y RLA + ++ ++ ++T+T LG RA Sbjct: 374 QN--VQVVNPSWMSGGVTVMANLI-LPYNRLAILAFSLIVVGIAWAVLTKTRLGLFVRAV 430 Query: 181 EQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFTAAV 240 Q+++MA +GV RV S F GA +A + G + I G + +G + +F A V Sbjct: 431 TQNRRMAACVGVKTARVDSYAFAFGAGIAGLGGCALSQI-GNVGPDLGQSYIIDSFMAVV 489 Query: 241 LGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGL 292 LGG+G L G ++GG +GL+ + G+ +A ++VL + RP G+ Sbjct: 490 LGGVGQLAGTVIGGFGLGLVSKAIEPFWGAVLAKIAVLVLIVLFIQKRPQGM 541 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 551 Length adjustment: 31 Effective length of query: 270 Effective length of database: 520 Effective search space: 140400 Effective search space used: 140400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory