GapMind for catabolism of small carbon sources

 

Aligments for a candidate for CCNA_00435 in Paraburkholderia bryophila 376MFSha3.1

Align Amino acid transporter (characterized, see rationale)
to candidate H281DRAFT_02180 H281DRAFT_02180 amino acid/polyamine/organocation transporter, APC superfamily

Query= uniprot:A0A0H3C3Q5
         (483 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02180 H281DRAFT_02180 amino
           acid/polyamine/organocation transporter, APC superfamily
          Length = 463

 Score =  369 bits (948), Expect = e-107
 Identities = 202/474 (42%), Positives = 284/474 (59%), Gaps = 22/474 (4%)

Query: 13  RRKAIDTITAGHADSHQLKKTLSWPHLVALGVGAIVGTGIYTLTGVGAGLAGPGVILSFL 72
           R+K+++ + A  A +  LKK L    L  LGVGAI+GTGI+ LTG GA  AGP +++SFL
Sbjct: 5   RKKSVEHMIATSAQNAGLKKALGALDLTFLGVGAIIGTGIFVLTGTGAVQAGPALMVSFL 64

Query: 73  IAGAVCACAALCYAELSTMIPASGSAYTYSYAAMGEPVAWFVGWSLILEYTLVCAAVAVG 132
           IA   C  AAL YAE ++ IP +GS YTYSYA +GE  AW +GW L+LEY L  +AV+VG
Sbjct: 65  IAAVACGFAALAYAEFASTIPVAGSIYTYSYATLGELAAWIIGWDLMLEYGLATSAVSVG 124

Query: 133 WSAHAHGLFKMIG--FPDALLAGP-----HQGGLINMPAVFISMAVAGLLALGTRESATV 185
           WS +   L    G   P AL A P     H+  L N+PA  + MA+  LL++G RESA +
Sbjct: 125 WSGYLQSLLSGFGVSLPVALTAAPGALPGHET-LFNLPAFLVMMAITALLSVGVRESARI 183

Query: 186 NMVLVFVKIIALIVFVVLCLPAFNLAHFTPFMPNGFQAHVPEGAAADAAKVGVMAAASLI 245
           N ++V +K++ +++ + + +     A++ PFMPNG+               GV  AA+++
Sbjct: 184 NNIMVAIKVVVVLLVIAVGVFHVTPANWHPFMPNGWN--------------GVFGAAAVM 229

Query: 246 FFAFYGFDAVSTAAEETKNPKRDLTIGIVGSMAVCTAIYMIVAAVSIGASRTEVFSKSEA 305
           FFAF GFD+VS+AAEE KNPKRDL IGI+ S+ VC  +Y+ VAAV  G   +  F+    
Sbjct: 230 FFAFIGFDSVSSAAEEVKNPKRDLPIGIIASLGVCAVLYVAVAAVVTGIVPSAQFANISH 289

Query: 306 PLVFILESLNHGKIAQLVALAAVIALPTVILAFMYGQSRIFFVMARDGLLPRALSKVNAK 365
           P+ + L+      +A  + L AV+ + TVIL   YGQ+R+ F M+RDGLLP  LS+V+ +
Sbjct: 290 PVSYALQVAGQKWVAGFIDLGAVLGMLTVILVMAYGQTRVIFAMSRDGLLPARLSRVHPR 349

Query: 366 TGTPVMMTLLTGVLAAVISGLLSLKDIAELANAGTLWAFIAVGASVILLRLREPNRPRVF 425
             TP   T L G+   +I  L+ L  +AEL N GTL AF  V  +V++LR   P  PR F
Sbjct: 350 FATPFFTTWLVGIFFGLIGALVPLNVLAELINIGTLAAFSMVSIAVLVLRKTHPELPRAF 409

Query: 426 STPLWPIVAPAGILGCLYLFLSLPGKTQLYFLYAHLIGAVVYLAYGMRKSVLAQ 479
             P  P+V    +  C++L  +L   T + F+   LIG V+Y  Y  R+S LA+
Sbjct: 410 RCPGVPVVPVLAVASCVFLMANLQAVTWVAFVVWLLIGMVIYFGYSRRRSHLAR 463


Lambda     K      H
   0.326    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 635
Number of extensions: 32
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 483
Length of database: 463
Length adjustment: 33
Effective length of query: 450
Effective length of database: 430
Effective search space:   193500
Effective search space used:   193500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory