Align ABC transporter permease (characterized, see rationale)
to candidate H281DRAFT_00093 H281DRAFT_00093 amino acid/amide ABC transporter membrane protein 1, HAAT family
Query= uniprot:A0A165KC95 (309 letters) >FitnessBrowser__Burk376:H281DRAFT_00093 Length = 551 Score = 128 bits (321), Expect = 4e-34 Identities = 94/292 (32%), Positives = 144/292 (49%), Gaps = 13/292 (4%) Query: 11 GLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPGAPGWVIL 70 GL LGS+ L ALG + YG+I +IN AHGE LMIGA ++ + Q PG W Sbjct: 261 GLSLGSVLLLAALGLAITYGLIGVINMAHGEFLMIGAYATYVVQNLFQRFAPGGFDW-YP 319 Query: 71 LLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMS-ILLQTLAMIIWKPNYKP 129 L+A + V AA + VIE++ + L P L L+T G+S IL+Q M+ N + Sbjct: 320 LVAVPASFVAAALVGIVIERLVLKHLYGRP-LETLLTTFGISLILIQATRMLFGAQNVQV 378 Query: 130 Y-PTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRATAENPRVAS 188 P+ + + + ++ IL + + + ++ T LG +RA +N R+A+ Sbjct: 379 VNPSWMSGGVTVMANLILPYNRLAILAFSLIVVGIAWAVLTKTRLGLFVRAVTQNRRMAA 438 Query: 189 LMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAVFGGIGNLA 248 +GVK V S F GA +A + G S G +G + +F A V GG+G LA Sbjct: 439 CVGVKTARVDSYAFAFGAGIAGLGGCA-LSQIGNVGPDLGQSYIIDSFMAVVLGGVGQLA 497 Query: 249 GAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGL 300 G V+GG LGL+ S I G +L I +++++ + RP G+ Sbjct: 498 GTVIGGFGLGLV----SKAIEPFWGAVLAK----IAVLVLIVLFIQKRPQGM 541 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 551 Length adjustment: 31 Effective length of query: 278 Effective length of database: 520 Effective search space: 144560 Effective search space used: 144560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory