Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate H281DRAFT_05513 H281DRAFT_05513 branched-chain amino acid transport system permease protein
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Burk376:H281DRAFT_05513 Length = 597 Score = 173 bits (438), Expect = 9e-48 Identities = 100/250 (40%), Positives = 142/250 (56%), Gaps = 8/250 (3%) Query: 19 LLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFN 78 L + +SK +GG+ AV V G I GLIGPNGAGK+TL NL++ D G V + Sbjct: 346 LTVESVSKQYGGVLAVSDVSFSVAAGQIHGLIGPNGAGKSTLVNLIAGNYLCDSGRVRLD 405 Query: 79 GDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRV-- 136 G + L A RG RTFQ +++ L VLEN+LL G + NF + Sbjct: 406 GADVSNLVTADRAKRGLARTFQNLQLVEALPVLENVLLGMSSADGH-----VANFAKWWM 460 Query: 137 -QKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAA 195 + + R +A+ +L G+ Q Y LS G RKL+E+ARA+ P+L+LLDEP A Sbjct: 461 GRAFDLPERREALEILAFFGIEHLCQAYPTELSYGHRKLVELARAIAQRPRLMLLDEPIA 520 Query: 196 GVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQS 255 G+N ++ + + G+T L+IEHNM+ +M+LC + VL +GR + GTPE+I+S Sbjct: 521 GLNGAEAMEVAKVVGRLRDAGVTILLIEHNMEFVMSLCDSISVLEQGRLIGTGTPEEIRS 580 Query: 256 DPRVLEAYLG 265 D R+L AYLG Sbjct: 581 DERILRAYLG 590 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 597 Length adjustment: 31 Effective length of query: 236 Effective length of database: 566 Effective search space: 133576 Effective search space used: 133576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory