Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate H281DRAFT_00987 H281DRAFT_00987 glycine betaine/proline transport system ATP-binding protein
Query= SwissProt::P17328 (400 letters) >FitnessBrowser__Burk376:H281DRAFT_00987 Length = 429 Score = 370 bits (951), Expect = e-107 Identities = 204/391 (52%), Positives = 268/391 (68%), Gaps = 3/391 (0%) Query: 5 LEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSG 64 L VKNL KIFG P+RA + I +GL + +I E+TG + V D SL+++ GEIFV+MGLSG Sbjct: 38 LTVKNLSKIFGPRPERAAELIRQGLGRNEIFEQTGNMVAVNDVSLSVKAGEIFVVMGLSG 97 Query: 65 SGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVL 124 SGKST+VRLLNRLIEPT GQV+++G DIA +S ELR+VRRKK+AMVFQSFAL+P+ TVL Sbjct: 98 SGKSTLVRLLNRLIEPTSGQVILEGRDIAPMSTPELRDVRRKKMAMVFQSFALLPNRTVL 157 Query: 125 DNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGMRQRVGLARALAINPD 184 DN A+G+E+AG+ ER + A AL +VGL +Y P ELSGGM+QRVGLARALA+NP Sbjct: 158 DNIAYGLEVAGLKKAERYDIARAALTRVGLGSYEKLLPGELSGGMQQRVGLARALAVNPS 217 Query: 185 ILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVV 244 +LLMDEAFSALDPLIR EMQ EL++LQ + QRTIVFISHD++EA++IG RI IM++G ++ Sbjct: 218 VLLMDEAFSALDPLIRFEMQSELLRLQKEEQRTIVFISHDIEEAIKIGGRIGIMKDGCLI 277 Query: 245 QVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLLQ 304 QVGTP E++ +PA+DYVR FFR VD+S+ A + R LI L L Sbjct: 278 QVGTPAELIQSPADDYVRDFFRNVDVSRFLKASSLMTRVERELISCDVAAPSERYLNQLI 337 Query: 305 DEDREYGYVIERGNKFVGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHVG 364 D + GYV + ++ G V+ SL+ + A I A ++D V L +L + Sbjct: 338 DSGADCGYVCDEAGRYQGCVTPASLRK--TGAHSIREAFVNDVNAVPLDADLHQLATIAL 395 Query: 365 QAPCAVPVVDEEHQYVGIISKRMLL-QALDR 394 VPV D + GI+S R +L Q ++R Sbjct: 396 NQQHDVPVTDTAGRLAGIVSCRAILKQVMER 426 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 429 Length adjustment: 31 Effective length of query: 369 Effective length of database: 398 Effective search space: 146862 Effective search space used: 146862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory