GapMind for catabolism of small carbon sources

 

Aligments for a candidate for proV in Paraburkholderia bryophila 376MFSha3.1

Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate H281DRAFT_02450 H281DRAFT_02450 glycine betaine/proline transport system ATP-binding protein

Query= SwissProt::P17328
         (400 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02450 H281DRAFT_02450 glycine
           betaine/proline transport system ATP-binding protein
          Length = 393

 Score =  361 bits (926), Expect = e-104
 Identities = 186/396 (46%), Positives = 268/396 (67%), Gaps = 8/396 (2%)

Query: 4   KLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLS 63
           K+ V+ L K+FG +P++A   +  G +KE++  +TG  +GV + S  ++EGEIFV+MGLS
Sbjct: 5   KVVVEGLCKVFGTNPKQALAMLAGGATKEEVFARTGQIVGVHNVSFEVKEGEIFVLMGLS 64

Query: 64  GSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTV 123
           GSGKST++RL+NRL+EP+ G+VLIDG D+A +  AEL  +RRK ++MVFQSFALMP  TV
Sbjct: 65  GSGKSTLIRLINRLVEPSAGKVLIDGRDVASVPRAELTALRRKDMSMVFQSFALMPQRTV 124

Query: 124 LDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGMRQRVGLARALAINP 183
           L N AFG+E+AG++ +ER  +A+  L QVGL  +A   P +LSGGM+QRVGLARALA+NP
Sbjct: 125 LSNAAFGLEVAGVSRKEREARAMTVLEQVGLAPFAAKLPAQLSGGMQQRVGLARALAVNP 184

Query: 184 DILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEV 243
            +++MDEAFSALDPL R EMQ+ L+ LQ + QRTI+F+SHDL+EAMRIG RIAIM+ G+V
Sbjct: 185 SLMIMDEAFSALDPLKRKEMQNVLLDLQREQQRTILFVSHDLEEAMRIGTRIAIMEGGKV 244

Query: 244 VQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLL 303
           VQ+GTP EI+ NPA+DYVR FF G+D S+  +A D+ +   V L+         S++   
Sbjct: 245 VQIGTPQEIITNPADDYVRAFFEGIDTSRYLTAGDLMQTDAVPLMHSHSPQIDASSVAAT 304

Query: 304 QDEDREYGYVIERGNKFVGVVSIDSLKAALSQAQGIEAALIDDPLVVDAQTPLSELLSHV 363
            +   +Y +V++   K  G V  D   +A ++   +E         +   TPL +++  V
Sbjct: 305 LNGSADYAFVLDSERKIRGFVCRDETGSASAKLNYVEC--------IRRTTPLDDVVERV 356

Query: 364 GQAPCAVPVVDEEHQYVGIISKRMLLQALDREGGNN 399
             +   +PVV+ +  Y G ++K  +L  L R  G++
Sbjct: 357 VASRAPLPVVEADGSYCGSVNKTNVLHVLTRHRGSH 392


Lambda     K      H
   0.319    0.137    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 421
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 393
Length adjustment: 31
Effective length of query: 369
Effective length of database: 362
Effective search space:   133578
Effective search space used:   133578
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory