Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate H281DRAFT_00988 H281DRAFT_00988 glycine betaine/proline transport system permease protein
Query= SwissProt::P14176 (354 letters) >FitnessBrowser__Burk376:H281DRAFT_00988 Length = 293 Score = 259 bits (662), Expect = 6e-74 Identities = 129/265 (48%), Positives = 185/265 (69%) Query: 64 LDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVFALIAWQISGV 123 + + ++++ HFR F + ++ + L +P +++ A GV Sbjct: 6 IGKFAENAVNFLFQHFRGGFDAFSAALGAVIKLLEDGLAAIPFIAMLVLLVAFALWRRGV 65 Query: 124 GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKIIRPL 183 V V+L+AI +G W+Q + TLALV+ A +F +VIG+PLGIW AR+ R ++R L Sbjct: 66 VFSVFVGVALMAIHYMGLWAQTVSTLALVVAATVFSLVIGVPLGIWGARNKRVEMVLRSL 125 Query: 184 LDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRS 243 LD MQT PAFVYL+P V+LFG+G VP V+ TI+F++PP++RLT LGI QV +L+EA RS Sbjct: 126 LDFMQTMPAFVYLIPAVILFGLGRVPAVIATIVFSMPPVVRLTTLGIRQVREELLEAGRS 185 Query: 244 FGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDM 303 FG++ Q+L+K+QLP A+P+IMAGVNQT+M+ALSMVV+ASMI GGLG+ VL GI RLD+ Sbjct: 186 FGSTDAQLLWKIQLPNALPSIMAGVNQTIMMALSMVVVASMIGAGGLGEYVLSGIQRLDI 245 Query: 304 GLATVGGVGIVILAIILDRLTQAVG 328 G+ GG+G+V+LAI+LDRLT++ G Sbjct: 246 GIGFEGGLGVVLLAIVLDRLTESFG 270 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 293 Length adjustment: 28 Effective length of query: 326 Effective length of database: 265 Effective search space: 86390 Effective search space used: 86390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory