Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate H281DRAFT_03484 H281DRAFT_03484 osmoprotectant transport system permease protein
Query= SwissProt::P14176 (354 letters) >FitnessBrowser__Burk376:H281DRAFT_03484 Length = 241 Score = 110 bits (274), Expect = 5e-29 Identities = 66/193 (34%), Positives = 107/193 (55%), Gaps = 5/193 (2%) Query: 160 IVIGLPLGIWLARSPRAAKIIRPLLDAMQTTPA---FVYLVPIVMLFG--IGNVPGVVVT 214 IV G+PLGI + + RAAKI+ + T P+ F ++P++ + G IG +P V+ Sbjct: 33 IVTGVPLGIVITANARAAKIVLYFAAILMTIPSVALFGLMIPVLSVIGQGIGFLPTVIAL 92 Query: 215 IIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLML 274 +++ PI+R T I + L EA+R G + RQ L+KV++P+A+P IMAGV +++ Sbjct: 93 FLYSQLPIVRNTYTAITNIDPALREAARGIGMTTRQRLWKVEIPIALPIIMAGVRMAVVI 152 Query: 275 ALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSRSR 334 + + +A+ I GGLG+++ RGI + D G + + +LAI D V R + Sbjct: 153 NVGIAAVAAYIGAGGLGKLISRGISQSDPRQLIAGAILVSLLAIAADYGLGWVQRLLTPK 212 Query: 335 GNRRWYTTGPVGL 347 G R TG + L Sbjct: 213 GLRSPSRTGRLAL 225 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 241 Length adjustment: 26 Effective length of query: 328 Effective length of database: 215 Effective search space: 70520 Effective search space used: 70520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory