Align Aconitate-delta-isomerase 1; Itaconic acid/2-hydroxyparaconate biosynthesis cluster protein ADI1; EC 5.-.-.- (characterized)
to candidate H281DRAFT_01376 H281DRAFT_01376 4-oxalomesaconate tautomerase
Query= SwissProt::A0A0U2X0E4 (443 letters) >FitnessBrowser__Burk376:H281DRAFT_01376 Length = 368 Score = 238 bits (606), Expect = 3e-67 Identities = 134/330 (40%), Positives = 191/330 (57%), Gaps = 13/330 (3%) Query: 5 IDTTIYRAGTSRGLYFLASDLPAEPSERDAALISIMGSGHPLQIDGMGGGNSLTSKVAIV 64 I + R GTS+G +F+ASDLPAEP+ERD L+++MGS P QIDG+GG + LTSKVAI+ Sbjct: 9 IPCMMIRGGTSKGAFFMASDLPAEPAERDRVLLAVMGSPDPRQIDGIGGADPLTSKVAII 68 Query: 65 SASTQRSEFDVDYLFCQVGITERFVDTAPNCGNLMSGVAAFAIERGLVQPHPSDTTCLVR 124 S S+ R + DVDYLF QV + E VD NCGN+++GV +AIERGLV T + Sbjct: 69 SPSS-REDADVDYLFAQVVVNEARVDFGQNCGNILAGVGPYAIERGLVNAEDGSTRVAIH 127 Query: 125 IFNLNSRQASELVIP----VYNGRVHYDDIDDMHMQRPSARVGLRFLDTVGSCTGKLLPT 180 + N + + P Y G D + +A + L F DT GS G LLPT Sbjct: 128 MVNTGQIAVATVRTPGCRVTYEGDARIDGVPG-----GAAPIPLEFRDTAGSTCGALLPT 182 Query: 181 GNASDWIDGLKVSIIDSAVPVVFIRQHDVGITGSEAPATLNANTALLDRLERVRLEAGRR 240 G D ++G++++ ID+ +P+V +R D+ TG E L+A+ L R+E++RL G Sbjct: 183 GRLKDTVEGVELTCIDNGMPLVLMRARDLQRTGYETREELDADNELKARIEKIRLVVGPM 242 Query: 241 MGLGDVSGSVVPKLSLIGPGTETTTFTARYFTPKACHNAHAVTGAICTAGAAYIDGSVVC 300 M LGDVS VPK+ L+ T + R F P CH + V GA+ A AA + G+ VC Sbjct: 243 MNLGDVSARTVPKMCLVAEPRNGGTISTRSFIPHRCHASIGVLGAVSVATAAVLPGT-VC 301 Query: 301 EILSSRASACSASQRRISIEHPSGVLEVGL 330 + ++ +++R+S+EHP+G V L Sbjct: 302 DGIAK--VELEGARKRVSVEHPTGEFTVEL 329 Lambda K H 0.318 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 368 Length adjustment: 31 Effective length of query: 412 Effective length of database: 337 Effective search space: 138844 Effective search space used: 138844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory