Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate H281DRAFT_05492 H281DRAFT_05492 putative spermidine/putrescine transport system ATP-binding protein
Query= TCDB::P31134 (377 letters) >FitnessBrowser__Burk376:H281DRAFT_05492 Length = 372 Score = 258 bits (659), Expect = 2e-73 Identities = 144/354 (40%), Positives = 215/354 (60%), Gaps = 12/354 (3%) Query: 19 LLEIRNLTKSYDGQH-AVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIM 77 +++ + KSYDG++ V D++L+I +GE LLGASG GK+T L MLAGFE P+ G I Sbjct: 6 IIDFVGVQKSYDGENLVVKDLNLSIRRGEFLTLLGASGSGKTTTLMMLAGFETPTLGGIW 65 Query: 78 LDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLV 137 ++G + VP + R I M+FQ+YALFPHMTVEQN+A+ L+ + + E ++V + +V Sbjct: 66 MNGKPIETVPAHKRGIGMVFQNYALFPHMTVEQNLAYPLRMRNVSRNETVAKVKRAVDMV 125 Query: 138 HMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILE 197 + +R+P +LSGGQ+QRVALAR++ P+L+L+DEP+GALDK LR+ MQ E+ + Sbjct: 126 RLHGMERRRPSELSGGQQQRVALARAMVFEPELILMDEPLGALDKNLREHMQYEIKQLHH 185 Query: 198 RVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFE 257 +GVT V VTHDQ EAMTM+ RIA+ +G QIG P+E+YE P A FIG N Sbjct: 186 ELGVTVVYVTHDQAEAMTMSDRIAVFQQGVISQIGSPDELYERPANLDVASFIGESNRLT 245 Query: 258 GVLKERQEDGLVLDSPGLVHPLKVDADAS----VVDNVPVHVALRPEKIMLCEEPPANGC 313 G + G ++D+ L L ++ ++ +D V V + +RPE++ + + + Sbjct: 246 GTV---VSVGSMVDTVRLTSGLSLEVPSTSPVREIDRV-VEIVVRPERVSIEQGSADDQW 301 Query: 314 NFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWGDEVRLCW 367 + G V + YLGD + SG A++ A+R LP+ G E+R W Sbjct: 302 QWLQGRVSDLTYLGDHLRVLLVTDSGDSFIAKVSGAYR---ALPSVGQELRFGW 352 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 372 Length adjustment: 30 Effective length of query: 347 Effective length of database: 342 Effective search space: 118674 Effective search space used: 118674 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory