Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate H281DRAFT_04948 H281DRAFT_04948 putative spermidine/putrescine transport system permease protein
Query= CharProtDB::CH_088337 (275 letters) >FitnessBrowser__Burk376:H281DRAFT_04948 Length = 417 Score = 154 bits (390), Expect = 2e-42 Identities = 78/228 (34%), Positives = 128/228 (56%), Gaps = 5/228 (2%) Query: 36 MVFTLDNYTRLLDPLYFEVLLHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLL 95 + F DN + +Y + +++++ TL CLVLGYP AW LA LP K L+ L+ Sbjct: 185 LAFVADNAS-----VYRQAFARTISISATVTLLCLVLGYPVAWLLANLPAKSSNRLMLLV 239 Query: 96 IVPFWTNSLIRIYGLKIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFM 155 IVPFWT+ L+R + L G +N + LG+ P+ ++F + V+IG+ ++LLP+M Sbjct: 240 IVPFWTSLLVRTTAWYVLLQPGGVINSLVTGLGLATHPLPLIFNRTGVLIGMTHVLLPYM 299 Query: 156 VMPLYSSIEKLDKPLLEAARDLGASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVS 215 ++ +YS ++ + + AA+ LGA F+RI +P T+PG+ AGC LV + A+G + Sbjct: 300 ILAIYSVMKSVSPVYMRAAQSLGAHPFTAFVRIYVPQTLPGVGAGCFLVFVLALGYYITP 359 Query: 216 DLMGGAKNLLIGNVIKVQFLNIRDWPFGAATSITLTIVMGLMLLVYWR 263 L+GGA + +I +I +Q +W A S L I + ++ R Sbjct: 360 ALLGGAGDEMISQLIAMQTNTQLNWGLAGALSAYLVIFTAIFYFLFNR 407 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 417 Length adjustment: 28 Effective length of query: 247 Effective length of database: 389 Effective search space: 96083 Effective search space used: 96083 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory