Align Putrescine transport system permease protein PotI (characterized)
to candidate H281DRAFT_05183 H281DRAFT_05183 putrescine transport system permease protein
Query= SwissProt::P0AFL1 (281 letters) >FitnessBrowser__Burk376:H281DRAFT_05183 Length = 271 Score = 312 bits (799), Expect = 6e-90 Identities = 148/258 (57%), Positives = 200/258 (77%) Query: 16 LLLGFTFLYAPMLMLVIYSFNSSKLVTVWAGWSTRWYGELLRDDAMMSAVGLSLTIAACA 75 L LGF FLY P++ L++YSFN S+LVTVW +STRWY LL+DD +++A LSL +A Sbjct: 12 LALGFLFLYVPIVSLIVYSFNESQLVTVWTRFSTRWYAALLQDDELIAAAWLSLRVAVLT 71 Query: 76 ATAAAILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALAHAIGWP 135 A A+ I+GT A VL R GRFRG + MI APLV+P+VI G+SLLLLF+ +A +GWP Sbjct: 72 AFASVIIGTWAGFVLARMGRFRGFTLYTGMINAPLVIPEVIQGISLLLLFIEMAKWLGWP 131 Query: 136 ADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMP 195 A RG+ TIW+ HV C +YVA+++ SR++EL S+EEAA+DLGATPL+VFF ITLP+I Sbjct: 132 AGRGIFTIWIGHVMLCISYVAIIVQSRVKELHPSLEEAALDLGATPLRVFFSITLPLISQ 191 Query: 196 AIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALATLILGAVGI 255 A++SGWLL+FTLS+DDLV+++F+SGPG+TTLP++VFS VR+G+NPE+NALATL + V + Sbjct: 192 ALVSGWLLSFTLSIDDLVLSAFLSGPGSTTLPLVVFSRVRLGLNPEMNALATLFIAVVTV 251 Query: 256 VGFIAWYLMARAEKQRIR 273 Y M RAE++R++ Sbjct: 252 GVVAVNYFMQRAERRRVQ 269 Lambda K H 0.330 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 271 Length adjustment: 25 Effective length of query: 256 Effective length of database: 246 Effective search space: 62976 Effective search space used: 62976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory