Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate H281DRAFT_05440 H281DRAFT_05440 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)
Query= reanno::Smeli:SM_b21112 (281 letters) >FitnessBrowser__Burk376:H281DRAFT_05440 Length = 283 Score = 160 bits (405), Expect = 3e-44 Identities = 93/279 (33%), Positives = 155/279 (55%), Gaps = 14/279 (5%) Query: 1 MKLLRYGEPGQEKPGLLGSDGII---RDLSGHVSDL----AAGALDPSKLDELANLDVET 53 MKL+ + G++ D +I + L+G +DL AA AL + + A D Sbjct: 1 MKLVSFSTHQGPSFGVVRGDSVIDLGKRLNGRYADLKALIAANALGEAA--QAAQGDKGD 58 Query: 54 LPAVSGNPRLGPCVAGTGKFICIGLNYSDHAAETGATVPPEPIIFMKATSAIVGPNDDLV 113 P L P + + C+GLNY++H ET +P+IFM+ ++ VG ++ Sbjct: 59 YPL--SEVTLLPVIPNPDQIFCVGLNYAEHVKETNRETTEQPVIFMRLPASQVGHGQPML 116 Query: 114 LPRGSEKTDWEVELGIVIGKTAKYVSEAEALDYVAGYCTVHDVSERAFQTERHG-QWTKG 172 P S++ D+E E+ ++IG+ + ++EA+A +++AGY +D S R +Q RH QW G Sbjct: 117 RPPESQQFDYEGEIAVIIGRGGRRIAEADAWNHIAGYACYNDGSVRDWQ--RHTTQWGPG 174 Query: 173 KSCDTFGPTGPWLVTKDEVADPQDLAMWLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMS 232 K+ G GPW+VT DE+ + + ++NG+ +Q +T+ +++G A ++YLS F Sbjct: 175 KNFYRTGAFGPWMVTSDEIEPNALMMLVTRLNGQEVQRATTQMLIHGIAKQIAYLSTFTP 234 Query: 233 LRPGDIISTGTPPGVGMGMKPPRYLKAGDVVELGIEGLG 271 L PGD+I TGTP GVG PP +++ GD VE+ ++ +G Sbjct: 235 LAPGDVIVTGTPGGVGAKRNPPLFMEPGDRVEVEVDRIG 273 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 283 Length adjustment: 26 Effective length of query: 255 Effective length of database: 257 Effective search space: 65535 Effective search space used: 65535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory