GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aldA in Paraburkholderia bryophila 376MFSha3.1

Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate H281DRAFT_02299 H281DRAFT_02299 aldehyde dehydrogenase

Query= metacyc::MONOMER-16244
         (495 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02299 H281DRAFT_02299
           aldehyde dehydrogenase
          Length = 506

 Score =  352 bits (904), Expect = e-101
 Identities = 205/484 (42%), Positives = 281/484 (58%), Gaps = 17/484 (3%)

Query: 24  FINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSSWSTSDPQVR 83
           FI  E+V+    + F  VSP T E  T +  +   D++ A++AA  A  ++W  +    R
Sbjct: 22  FIGGEWVKPAGGEYFDNVSPITGEPFTSIPRSREADVELALDAAHRA-KAAWGKTSTTDR 80

Query: 84  MKVLYKLADLIDEHADTLAHIEALDNGKSLM-CSKGDVALTAAYFRSCAGWTDKIKGSVI 142
             +L ++AD ++ +   LA  E +DNGK L      D+ L   +FR  AG     +GS+ 
Sbjct: 81  ANILNRIADRMEANLQRLAVAETIDNGKPLRETMAADIPLAIDHFRYFAGAVRAQEGSIS 140

Query: 143 ETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSALYL 202
           E  D    Y   EP+GV GQIIPWNFP+LMA WKL P L  G   VLK AE TP S L L
Sbjct: 141 EIDDDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALAAGNCVVLKPAEQTPASILVL 200

Query: 203 ASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNLKK 262
             LI++   P GV+NVV+GFG  AG P++S  +I K+AFTG T TGR IM+ A++ N+  
Sbjct: 201 VELIQDL-LPAGVLNVVNGFGLEAGKPLASSKRIAKIAFTGETTTGRLIMQYASQ-NIIP 258

Query: 263 VTLELGGKSPNIVF------DDADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKI 316
           VTLELGGKSPNI F      DD+     ++        N GEVC   SR+ + E IYD  
Sbjct: 259 VTLELGGKSPNIFFADVMNQDDSYFDKALEGFAM-FALNQGEVCTCPSRVLIDEKIYDSF 317

Query: 317 VSEFKNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFG--- 373
           +        ++  G P    T +GAQ SQ QL+KIL Y+D+GK+EGA  + GGER     
Sbjct: 318 MERALKRVAAITQGHPLDTRTMIGAQASQEQLEKILSYVDLGKQEGAECLIGGERNTLSG 377

Query: 374 --NKGYFIKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHT 431
             +KGY++KPT+F    +  +I ++EIFGPVV++T FKT EE + +AND+ YGL AGV T
Sbjct: 378 ELSKGYYVKPTVFRGHNK-MRIFQEEIFGPVVSVTTFKTEEEALEIANDTLYGLGAGVWT 436

Query: 432 TNLSTAISVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKAVRI 491
            + + A     +I +G +W N Y+ +     FGGY QSGIGRE  +  LD+Y Q K + +
Sbjct: 437 RDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLV 496

Query: 492 GLSQ 495
             S+
Sbjct: 497 SYSE 500


Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 587
Number of extensions: 24
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 495
Length of database: 506
Length adjustment: 34
Effective length of query: 461
Effective length of database: 472
Effective search space:   217592
Effective search space used:   217592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory