Align RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate H281DRAFT_01120 H281DRAFT_01120 monosaccharide ABC transporter membrane protein, CUT2 family
Query= TCDB::Q7BSH3 (333 letters) >FitnessBrowser__Burk376:H281DRAFT_01120 Length = 333 Score = 189 bits (480), Expect = 8e-53 Identities = 114/302 (37%), Positives = 174/302 (57%), Gaps = 2/302 (0%) Query: 8 RETLLFLIIVVMIVVFSTRAADFATPGNLAGIFNDTSILIILALAQMTVILTKSIDLSVA 67 R L++ V++VVFS + F + N I T+++ I+A+ VI+ + IDLSV Sbjct: 34 RPYALYIAFAVLLVVFSFASPWFLSIDNFLNIGRQTALVSIIAIGMTFVIIARQIDLSVG 93 Query: 68 ANLAFTGMAIAMMNAAHPDLPLVVLILMAVVIGACLGAINGFLVWALEIPPIVVTLGTLT 127 ++LA +GM+ A+ A D L+ + + GA +G ING + L IP +VTLG+L+ Sbjct: 94 SSLALSGMSAALAMAYIGDHWLIGAVA-GIGTGALVGVINGLVTTRLNIPSFLVTLGSLS 152 Query: 128 IYRGMAFVLSGGAWVNAHQMTPIFLSVPRTPVLGLPVLSWVGIIIVILMYVLLRYTQFGR 187 RG+A +++ V + I + + G+PV ++ VI +LL Y+ FGR Sbjct: 153 AARGLALLVTTTKPVIITNDSFIAI-FGEGDIAGVPVPIIWTVLAVIAGILLLHYSVFGR 211 Query: 188 SAYATGGNPTAAVYAGIDTGWTKFLAFVLSGALAGLASYLWVSRYAVAYVDIANGFELDS 247 YA GGNPTAA Y+GID LAF+L+G LAGLA+ + +R A D+ G ELD Sbjct: 212 QVYAAGGNPTAARYSGIDIRRVTTLAFILTGVLAGLAALVLSARSHAARPDVVQGLELDV 271 Query: 248 VAACVIGGISIAGGVGSVAGTVLGALFLGVIKNALPVIGISPFTQMAISGTVIILAVAFN 307 +A+ +GG S+ GG G V GT+LG+L +G + N L ++G+S Q+ I G +I+ AVAF Sbjct: 272 IASVTLGGCSLFGGRGFVLGTLLGSLIIGTLNNGLVLLGVSSSLQLVIKGIIIVAAVAFT 331 Query: 308 AR 309 + Sbjct: 332 KK 333 Lambda K H 0.328 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 333 Length adjustment: 28 Effective length of query: 305 Effective length of database: 305 Effective search space: 93025 Effective search space used: 93025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory