GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rhaQ in Paraburkholderia bryophila 376MFSha3.1

Align RhaQ (characterized, see rationale)
to candidate H281DRAFT_01221 H281DRAFT_01221 monosaccharide ABC transporter membrane protein, CUT2 family

Query= uniprot:Q7BSH2
         (337 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_01221 H281DRAFT_01221
           monosaccharide ABC transporter membrane protein, CUT2
           family
          Length = 338

 Score =  219 bits (557), Expect = 1e-61
 Identities = 121/332 (36%), Positives = 196/332 (59%), Gaps = 7/332 (2%)

Query: 7   QPEKRIIPDRLGTPLRRIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEK 66
           +P+  ++  +  TPL+     WEVLL  V +L      + SP FL   NLS+   + TE 
Sbjct: 3   KPDSALLTRKRETPLQ-----WEVLLVIVLILSIALGRVLSPVFLTGANLSNVLADLTEI 57

Query: 67  AMIAFAMALLVISGEIDLSVAAIIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNG 126
           A++A  M L++++ EIDLSVA+++  +S  MG    +G+  P ++ + +  G   G+ NG
Sbjct: 58  ALMALPMTLIIVAAEIDLSVASVLGASSALMGVLWHMGLPMPVVIALVLVAGALAGLLNG 117

Query: 127 VLVSVLKLPSIVVTIGTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVF-SFEFVL 185
           +++  L LPS+ VTIGT++LFRG++Y++LGDQA   +P  +  FG   +   F    F +
Sbjct: 118 LVIVKLNLPSLAVTIGTLALFRGLAYVLLGDQAVADFPPAYTAFGMDTLGGTFVPLPFAI 177

Query: 186 FIVLAVLFAILLHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCL 245
            +V AVLF +LL +T FGR +YAIG N  AA FSGI V +++  LF+L+G+M  +A V  
Sbjct: 178 VMVGAVLFTVLLQSTAFGRSLYAIGANPTAAAFSGIEVTKIRLRLFVLSGLMGALAGVVY 237

Query: 246 TSRLGSTRPSIAQGWELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNL 305
           T R  S R    +G+EL V+  V+ GG+SI GG     GV +++  ++G++   L L ++
Sbjct: 238 TLRFTSARGDNGEGFELSVIAAVLFGGVSIFGGRGSMIGV-LLSLLIIGVLKNALTLDDV 296

Query: 306 PGIVMSIFIGLLIIVTIAIPIIARRIKLMSSR 337
               ++I  G+L++ ++ IP +  R +    R
Sbjct: 297 SSETLTIVTGVLLLASVLIPNLVARWRAARDR 328


Lambda     K      H
   0.330    0.145    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 319
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 338
Length adjustment: 28
Effective length of query: 309
Effective length of database: 310
Effective search space:    95790
Effective search space used:    95790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory