Align RhaQ (characterized, see rationale)
to candidate H281DRAFT_02714 H281DRAFT_02714 monosaccharide ABC transporter membrane protein, CUT2 family
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__Burk376:H281DRAFT_02714 Length = 331 Score = 189 bits (481), Expect = 6e-53 Identities = 102/299 (34%), Positives = 172/299 (57%), Gaps = 3/299 (1%) Query: 29 EVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISGEIDLSVAA 88 E+ + +V +L+ + S+ SPYFL NL +F+ A+++ M L++I+G IDLSV + Sbjct: 27 ELNVLSVLLLVGLLISVFSPYFLTTNNLMGVFRSFSLIALMSIGMMLVIITGGIDLSVGS 86 Query: 89 IIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNGVLVSVLKLPSIVVTIGTMSLFR 148 ++ L+S Q G P + G+ G+A G FNG +++ ++LP + T+GT+S+ R Sbjct: 87 VMGLSSLVTALVFQHGYNAPAAIGAGLAVGIAVGAFNGFMITWIQLPPFIATLGTLSIGR 146 Query: 149 GISYIVL-GDQAYGKYPADFAYFGQGYVVWVFSFEFVLFIVLAVLFAILLHATNFGRQVY 207 G+ YI+ G P F + GQGY+ +V F V+ + + +F++++ T FGR VY Sbjct: 147 GLMYIITKGVPVTPDVPDSFTFIGQGYIGFV-PFPVVILLAMTAVFSVVMRQTRFGRYVY 205 Query: 208 AIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTRPSIAQGWELEVVTM 267 A G N+ AAR SG+ RVK +++L+G+++ +A V SR S P+ G EL+V+ Sbjct: 206 ATGGNEVAARLSGVRTARVKFTVYVLSGLIASMAGVIAFSRFVSAEPASGFGAELDVIAA 265 Query: 268 VVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMSIFIGLLIIVTIAIPI 326 +GG S+ GG G +I A + G++T G+ LLN+ G +I++ ++I I Sbjct: 266 AAIGGASLSGGAGSVEGA-IIGAALAGIITNGVVLLNIDTYAQQAITGCVILIAVSIDI 323 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 331 Length adjustment: 28 Effective length of query: 309 Effective length of database: 303 Effective search space: 93627 Effective search space used: 93627 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory