Align D-ribose-binding periplasmic protein; EC 3.6.3.17 (characterized)
to candidate H281DRAFT_02705 H281DRAFT_02705 monosaccharide ABC transporter substrate-binding protein, CUT2 family
Query= CharProtDB::CH_003593 (296 letters) >FitnessBrowser__Burk376:H281DRAFT_02705 Length = 365 Score = 176 bits (445), Expect = 9e-49 Identities = 109/293 (37%), Positives = 163/293 (55%), Gaps = 13/293 (4%) Query: 16 SATVSANAMAKDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNLVVLDSQNNPAKELANV 75 SA V+ + K + VSTLNN FFV LK G +K A + G++LV ++ + +++ + Sbjct: 53 SAPVANASGGKTKVGFSVSTLNNAFFVGLKAGVEKGAKEQGFDLVQTNANGDAQQQVNDA 112 Query: 76 QDLTVRGTKILLINPTDSDAVGNAVKMANQANIPVITLDRQATKGEVVSHIASDNVLGGK 135 +L +G L++NP DS A+ AV+ AN NIPV LDR + G+V S +ASDNV G+ Sbjct: 113 INLLSQGVTALVLNPIDSKAIIPAVEKANSMNIPVFMLDRGSDGGKVTSFVASDNVALGQ 172 Query: 136 IAGDYIA----KKAGEG-AKVIELQGIAGTSAARERGEGFQQAVAAH-KFNVLASQPADF 189 A +IA K+ G V++L G+ GT+AA +R +GF +A + V+A Q F Sbjct: 173 TAAKWIADQLTKRYGSAKGNVVDLIGLVGTTAATDREKGFSDEIAKYPDIKVVARQEGAF 232 Query: 190 DRIKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAG-------KSDVMVVGFDGT 242 D+ K LN M N+L +P + AVF ND+ +GA +A+ AG K ++V+G DGT Sbjct: 233 DQEKSLNAMTNILQKYPQIDAVFGANDDNTVGAEKAIDNAGRYKPLGDKQHILVIGADGT 292 Query: 243 PDGEKAVNDGKLAATIAQLPDQIGAKGVETADKVLKGEKVQAKYPVDLKLVVK 295 A+ GK ATI+Q P Q+ AK ++ ++V A Y L+ K Sbjct: 293 AQALSAIRAGKQDATISQNPIQMAAKSLQFVADYSAKKEVPANYAWPTLLIDK 345 Lambda K H 0.313 0.129 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 365 Length adjustment: 28 Effective length of query: 268 Effective length of database: 337 Effective search space: 90316 Effective search space used: 90316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory