Align LacI family transcriptional regulator (characterized, see rationale)
to candidate H281DRAFT_05225 H281DRAFT_05225 monosaccharide ABC transporter substrate-binding protein, CUT2 family
Query= uniprot:A0A161ZH48 (318 letters) >FitnessBrowser__Burk376:H281DRAFT_05225 Length = 320 Score = 462 bits (1188), Expect = e-135 Identities = 237/313 (75%), Positives = 275/313 (87%), Gaps = 2/313 (0%) Query: 8 RLLAVAMLAAASAALPVSSAFAETP--EKPKVALVMKSLANEFFLTMEDGAKAYQKDHSG 65 R++A A+LA AS ALP S+A+A+ KPKVALVMKSLANEFFLTME GAK YQK +S Sbjct: 8 RIVAAAILATASTALPFSAAYAQNAPAHKPKVALVMKSLANEFFLTMETGAKDYQKHNSS 67 Query: 66 DFELISNGIKDETDTAGQTRIVEQMILSKVNALVIAPADSKAMVPVIKKAVDAGITVINI 125 F+LI+NGIKDETDTA Q RIVEQMI+SKV+A+V+APADSKA+VPV+KKAVDAGI V+NI Sbjct: 68 QFDLITNGIKDETDTANQIRIVEQMIVSKVDAIVLAPADSKALVPVVKKAVDAGIIVVNI 127 Query: 126 DNQLDPAVVKSKNITVPFVGPDNRKGARLVGEYLAKQLKAGDEVGIIEGVSTTTNAQQRT 185 DN+LDP V+KSK++ VPFVGPDNRKGA+ VG+YLAK+LKAGDEVGIIEGVSTTTNAQQRT Sbjct: 128 DNRLDPDVLKSKDLNVPFVGPDNRKGAQKVGDYLAKKLKAGDEVGIIEGVSTTTNAQQRT 187 Query: 186 AGFKDAMEAAQIKVVSLQSGDWEIDKGGKVASSMLSEYPNIKALLAGNDSMAVGAVSAVR 245 AGFKDAM+ KVVS+QSG+WEIDKG VAS+ML+EYPN+KALLAGND+MA+GAVSAVR Sbjct: 188 AGFKDAMQTVGAKVVSVQSGEWEIDKGNAVASAMLNEYPNLKALLAGNDNMAIGAVSAVR 247 Query: 246 AAGKAGKVQVVGYDNINAIKPMLKDGRVLATADQFAARQAVFGIETALKIIKGETVDSGA 305 AAGK GKV VVGYDNINAIKPMLKDGRVLATADQ+AA+QAVFGI+TALK + S Sbjct: 248 AAGKQGKVMVVGYDNINAIKPMLKDGRVLATADQYAAKQAVFGIDTALKALSEHKKQSQL 307 Query: 306 NGVIETPVELVTK 318 +GV+ETP +LVTK Sbjct: 308 SGVVETPCDLVTK 320 Lambda K H 0.314 0.130 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 320 Length adjustment: 28 Effective length of query: 290 Effective length of database: 292 Effective search space: 84680 Effective search space used: 84680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory