Align ABC transporter permease (characterized, see rationale)
to candidate H281DRAFT_06397 H281DRAFT_06397 amino acid/amide ABC transporter membrane protein 1, HAAT family
Query= uniprot:A0A165KC95 (309 letters) >FitnessBrowser__Burk376:H281DRAFT_06397 Length = 286 Score = 156 bits (394), Expect = 6e-43 Identities = 97/305 (31%), Positives = 169/305 (55%), Gaps = 25/305 (8%) Query: 1 MDILLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGA 60 M++ L QI+NG+ +G +Y L+A+G ++V+G+++ +NFAHG M+GA + C MQ + Sbjct: 1 MNVYLLQIVNGIGVGMLYFLLAVGLSIVFGLLRFVNFAHGAFYMLGA---YFCYQAMQWS 57 Query: 61 MPGAPGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAM 120 M A I+ + L +V+EK+ R + + ++ +G+++++Q A+ Sbjct: 58 MS-------FWTALIVVPIAVGALAWVVEKLILRHVYAQQHEFHILVTVGLALVVQECAI 110 Query: 121 IIWKP--NYKPYPTMLPSSPFEIGGAFITPT-QILILGVTAVALASLVYLVNHTNLGRAM 177 ++W P + P ML + I G+F+ P ++ ++G TAV A L +++ T LG A+ Sbjct: 111 LVWGPLGDNVAVPDML--NGVVIWGSFVYPKYRLFVIGFTAVLAALLWWVLEGTRLGSAV 168 Query: 178 RATAENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFT 237 RA +E+ + SL+G+ V S F +GA AA+AG++ A G MG AF Sbjct: 169 RAGSESTEMVSLLGINVLRVFSLVFALGAATAALAGVLAAPIRG-VDPFMGIEALGVAFV 227 Query: 238 AAVFGGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRP 297 V GG+GN GA+VGG+L+G+++++ S L + ++ + +L LRP Sbjct: 228 VVVVGGMGNFLGALVGGLLVGIVQSVMS---------TLWPEGARLMIYVAMAAVLLLRP 278 Query: 298 SGLLG 302 +GLLG Sbjct: 279 NGLLG 283 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 286 Length adjustment: 26 Effective length of query: 283 Effective length of database: 260 Effective search space: 73580 Effective search space used: 73580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory