Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate H281DRAFT_06397 H281DRAFT_06397 amino acid/amide ABC transporter membrane protein 1, HAAT family
Query= TCDB::Q8YXD0 (288 letters) >FitnessBrowser__Burk376:H281DRAFT_06397 Length = 286 Score = 148 bits (373), Expect = 2e-40 Identities = 94/289 (32%), Positives = 159/289 (55%), Gaps = 14/289 (4%) Query: 1 MDIQTIQLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFVNTFGVN 60 M++ +Q IVNGI VG + L AVGL++ +G+LR NFAHG F LGAY + + ++ Sbjct: 1 MNVYLLQ-IVNGIGVGMLYFLLAVGLSIVFGLLRFVNFAHGAFYMLGAYFCYQAMQWSMS 59 Query: 61 IWLSMIVAVVGTVGVMLLSEKLLWSRMRSIRANSTTL-IIISIGLALFLRNGIILIWGGR 119 W ++IV + + + EKL+ +R + A I++++GLAL ++ IL+WG Sbjct: 60 FWTALIVVPIAVGALAWVVEKLI---LRHVYAQQHEFHILVTVGLALVVQECAILVWGPL 116 Query: 120 NQNYNLP-ITPALDIFGVKV-PQNQLLVLALAVLSIGALHYLLQNTKIGKAMRAVADDLD 177 N +P + + I+G V P+ +L V+ + L ++L+ T++G A+RA ++ + Sbjct: 117 GDNVAVPDMLNGVVIWGSFVYPKYRLFVIGFTAVLAALLWWVLEGTRLGSAVRAGSESTE 176 Query: 178 LAKVSGIDVEQVIFWTWLIAGTVTSLGGSMYGLITAVRPNMGWFLILPLFASVILGGIGN 237 + + GI+V +V + + +L G + I V P MG + F V++GG+GN Sbjct: 177 MVSLLGINVLRVFSLVFALGAATAALAGVLAAPIRGVDPFMGIEALGVAFVVVVVGGMGN 236 Query: 238 PYGAIAAAFIIGIVQEVSTPFLGSQYKQGVALLI---MILVLLIRPKGL 283 GA+ ++GIVQ V + + + +G L+I M VLL+RP GL Sbjct: 237 FLGALVGGLLVGIVQSV----MSTLWPEGARLMIYVAMAAVLLLRPNGL 281 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 286 Length adjustment: 26 Effective length of query: 262 Effective length of database: 260 Effective search space: 68120 Effective search space used: 68120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory