Align sorbitol-6-phosphate dehydrogenase; EC 1.1.1.140 (characterized)
to candidate H281DRAFT_01792 H281DRAFT_01792 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Query= CharProtDB::CH_091827 (259 letters) >FitnessBrowser__Burk376:H281DRAFT_01792 Length = 253 Score = 100 bits (250), Expect = 2e-26 Identities = 78/256 (30%), Positives = 137/256 (53%), Gaps = 18/256 (7%) Query: 6 VVIGGGQTLGAFLCHGLAAEGYRVAVVDIQSDKAAN-VAQEINAEYGESMAYGFGADATS 64 ++ GGG+ +GA AA+GY VA+ + + AA+ VA ++ A ++A AD+ Sbjct: 11 LITGGGRGVGAATARLAAAQGYDVAISFVSDESAAHAVAADVEAVGRRALAVR--ADSAD 68 Query: 65 EQSVLALSRGVDEIFGRVDLLVYSAGI-AKAAFISDFQLGDFDRSLQVNLVGYFLCARE- 122 + V L +D+ FGR+D+LV +A I A+ + + + + R VN +G LCA++ Sbjct: 69 PEQVAQLFAAIDQKFGRIDVLVNNAAIIAQQSALENLEFARMQRIFAVNAIGPILCAQQA 128 Query: 123 FSRLMIR-DGIQGRIIQINSKSGKVGSKHNS-GYSAAKFGGVGLTQSLALDLAEYGITVH 180 R+ R G G +I ++S S ++GS + Y+A+K T A ++A GI V+ Sbjct: 129 VKRMSYRYKGRGGVVINVSSASARLGSPNEYVDYAASKGAVETFTTGFAKEVARDGIRVN 188 Query: 181 SLMLGNLLKSPMFQSLLPQYATKLGIKPDQVEQYYIDKVPLKRGCDYQDVLNMLLFYASP 240 + G++ + M S G +P +V++ D +P+ RG ++V +L+ AS Sbjct: 189 CIRPGHIY-TDMHAS---------GGEPGRVDRVK-DSIPMGRGGQPEEVARAILWLASE 237 Query: 241 KASYCTGQSINVTGGQ 256 +AS+ TG ++VTGG+ Sbjct: 238 EASFITGTFLDVTGGK 253 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 253 Length adjustment: 24 Effective length of query: 235 Effective length of database: 229 Effective search space: 53815 Effective search space used: 53815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory