Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate H281DRAFT_04467 H281DRAFT_04467 UDP-glucose pyrophosphorylase
Query= BRENDA::Q8PK83 (297 letters) >FitnessBrowser__Burk376:H281DRAFT_04467 Length = 293 Score = 308 bits (789), Expect = 1e-88 Identities = 160/284 (56%), Positives = 203/284 (71%), Gaps = 1/284 (0%) Query: 4 RIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKH 63 ++ KAVFPVAGLGTRFLPATK PKEMLPI+DKPLIQYAV+EA+ AG +IFVT R K Sbjct: 3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKR 62 Query: 64 SIADYFDKAYELEQKLERAGKLEQLELVRHALPDGVRAIFVTQAEALGLGHAVLCAKAVV 123 +I D+FDK+YE+E +LE GK + LELVR P V +V Q EALGLGHAVLCA+ +V Sbjct: 63 AIEDHFDKSYEIEAELEARGKDKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEKLV 122 Query: 124 GNEPFAVLLPDDLMWNRGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDAFDG 183 G+ PFAV+L DDL++ +TQM V + SVI VE++P +T SYGIV ++ Sbjct: 123 GDNPFAVILADDLLYGT-PPVMTQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWED 181 Query: 184 RKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAELLKE 243 +++ IVEKP+P VAPSNL VVGRYVL P+IFD + + GAGGE+QLTDAI LL + Sbjct: 182 SIIKMSGIVEKPEPSVAPSNLGVVGRYVLKPRIFDHIRSIKPGAGGELQLTDAIQSLLAD 241 Query: 244 EQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILR 287 EQV A+++ G RFDCG+ +G ++ATV FAL H + E LR Sbjct: 242 EQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFDEYLR 285 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 293 Length adjustment: 26 Effective length of query: 271 Effective length of database: 267 Effective search space: 72357 Effective search space used: 72357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate H281DRAFT_04467 H281DRAFT_04467 (UDP-glucose pyrophosphorylase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.23675.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-120 385.4 0.0 8.3e-120 385.2 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_04467 H281DRAFT_04467 UDP-glucose pyro Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_04467 H281DRAFT_04467 UDP-glucose pyrophosphorylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 385.2 0.0 8.3e-120 8.3e-120 1 261 [] 4 265 .. 4 265 .. 0.99 Alignments for each domain: == domain 1 score: 385.2 bits; conditional E-value: 8.3e-120 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfD 66 + kav+P+aGlGtr+LPatka PkemlpivdkPliqy+veea++aGi+e+++vtgrskraiedhfD lcl|FitnessBrowser__Burk376:H281DRAFT_04467 4 VTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFD 69 679*************************************************************** PP TIGR01099 67 tsyeleaklekknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdl 131 +sye+ea+le ++k++ll+ vr+i ++ ++++yvrq ea GLGhavl+ae+lvgd+pfav+l+Ddl lcl|FitnessBrowser__Burk376:H281DRAFT_04467 70 KSYEIEAELEARGKDKLLELVRSIKPShVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDL 135 *************************988************************************** PP TIGR01099 132 vseeeealkqlielyektgasiiaveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsn 197 + + +++ q+ie+++++++s+i+vee+p++e+++YG++dg+e e+++++++ +vekP+p apsn lcl|FitnessBrowser__Burk376:H281DRAFT_04467 136 LYGTPPVMTQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWEDSIIKMSGIVEKPEPSVAPSN 201 ****************************************************************** PP TIGR01099 198 laivGrYvltpeifelleetkaGkggeiqltDalrlllekeevlavklkgkryDvGdklgylka 261 l +vGrYvl+p+if++++++k+G+gge+qltDa++ ll +e+vla+k +g+r+D+G+klgylka lcl|FitnessBrowser__Burk376:H281DRAFT_04467 202 LGVVGRYVLKPRIFDHIRSIKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKA 265 **************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (293 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.73 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory