Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate H281DRAFT_01850 H281DRAFT_01850 D-lactate dehydrogenase
Query= BRENDA::Q9I530 (329 letters) >FitnessBrowser__Burk376:H281DRAFT_01850 Length = 331 Score = 346 bits (888), Expect = e-100 Identities = 174/323 (53%), Positives = 224/323 (69%) Query: 1 MRILFFSSQAYDSESFQASNHRHGFELHFQQAHLQADTAVLAQGFEVVCAFVNDDLSRPV 60 M I FS++ YD E A+N H L + L +T LA VC FVND V Sbjct: 1 MDIAVFSAKPYDREYLNAANAGHHHRLQYFDVPLDIETVSLAANHGAVCIFVNDHADAAV 60 Query: 61 LERLAAGGTRLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRL 120 L+ L GGT+LVALR G+N+VDL AA+ LG+ VV V YSP+AVAEHAV L++ +NR++ Sbjct: 61 LQALVHGGTKLVALRCTGFNNVDLKAAQDLGIKVVRVVNYSPNAVAEHAVALLMAINRKI 120 Query: 121 HRAYNRTREGDFSLHGLTGFDLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPYPNPR 180 RAYNRTR+ +FSL GL GFDL+GK V VIGTG+IG F +IM GFGC ++ YD +P+ Sbjct: 121 QRAYNRTRDFNFSLDGLMGFDLNGKVVAVIGTGKIGRVFTKIMLGFGCSVIGYDKFPSAE 180 Query: 181 IQALGGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNA 240 +ALG RY + +DI+SLHCPLT +T H+IDA LA K GA+LINT RGAL++ Sbjct: 181 FEALGARYARPKEIGESADIISLHCPLTPETYHIIDASTLARAKRGALLINTSRGALIDT 240 Query: 241 AALIEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLT 300 A+I+ALKSGQLG L +DVYE+EAD+FF D S + DDVL RL++FPNV+VT HQAFLT Sbjct: 241 EAVIDALKSGQLGGLAIDVYEQEADLFFRDLSGTIITDDVLQRLVTFPNVIVTGHQAFLT 300 Query: 301 REALAAIADTTLDNIAAWQDGTP 323 REA+ I +TTL ++ ++ G P Sbjct: 301 REAVTTICETTLQSVTEFETGKP 323 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 331 Length adjustment: 28 Effective length of query: 301 Effective length of database: 303 Effective search space: 91203 Effective search space used: 91203 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory