Align Uncharacterized protein (characterized, see rationale)
to candidate H281DRAFT_02905 H281DRAFT_02905 L-lactate dehydrogenase complex protein LldE
Query= uniprot:B2TBW0 (256 letters) >FitnessBrowser__Burk376:H281DRAFT_02905 Length = 247 Score = 489 bits (1258), Expect = e-143 Identities = 236/247 (95%), Positives = 242/247 (97%) Query: 10 MKVALFIPCFIDAFYPEVGIATLELLERFGIQVDYPQEQTCCGQPMANSGAHAEAAGTER 69 MKVALFIPCFIDAFYPEVGIATLELLERFGIQVDYPQEQTCCGQPM NSGAHAEAAG ER Sbjct: 1 MKVALFIPCFIDAFYPEVGIATLELLERFGIQVDYPQEQTCCGQPMGNSGAHAEAAGAER 60 Query: 70 VFARNFAGYDYIVGPSASCIHHVREHLTALEQTDEVKKVRANAYELVEFLHDVVGAREFP 129 VFARNFAGYDYIVGPSASCIHHVREHLTA++QTDEVKKVRA+AYELVEFLHDVVGAREFP Sbjct: 61 VFARNFAGYDYIVGPSASCIHHVREHLTAIDQTDEVKKVRASAYELVEFLHDVVGAREFP 120 Query: 130 WAEFPHRVGLHNSCSALRHLKEASISEVAGAPFSKPRTLLEGVKGIEFVKPARPDECCGF 189 WAEFP+RVGLHNSCSALRHLKEASISEVAG PFSKPR LLEGVKGIEFVKP+RPDECCGF Sbjct: 121 WAEFPYRVGLHNSCSALRHLKEASISEVAGQPFSKPRALLEGVKGIEFVKPSRPDECCGF 180 Query: 190 GGTFSVTEEPVSVRMGQDKVRDHLNAGAEYIVSGDMSCLMHQQGCAERMKADARFIHIAQ 249 GGTFSVTEEPVSVRMGQDKVRDHLNAGA+YIVSGDMSCLMHQQGCAERMKADARFIHIAQ Sbjct: 181 GGTFSVTEEPVSVRMGQDKVRDHLNAGAQYIVSGDMSCLMHQQGCAERMKADARFIHIAQ 240 Query: 250 VLNGARA 256 VLNGA A Sbjct: 241 VLNGACA 247 Lambda K H 0.323 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 247 Length adjustment: 24 Effective length of query: 232 Effective length of database: 223 Effective search space: 51736 Effective search space used: 51736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory