Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate H281DRAFT_01054 H281DRAFT_01054 (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase
Query= BRENDA::O58389 (348 letters) >FitnessBrowser__Burk376:H281DRAFT_01054 Length = 356 Score = 158 bits (400), Expect = 2e-43 Identities = 106/326 (32%), Positives = 165/326 (50%), Gaps = 15/326 (4%) Query: 23 DVPKP---GPGEVLIKVLATSICGTDLHIYE-------WNEWAQSRIKPPQIMGHEVAGE 72 +VP P G ++++K + ICGTDLH Y+ + K PQ++GHE + E Sbjct: 16 NVPDPSGIGADQMIVKPMWCGICGTDLHEYQAGPIVVPTEPHPLTGAKAPQVLGHEFSAE 75 Query: 73 VVEIGPGVEGIEVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTD-GVFAEYAVV 131 V+E+G V+ + GD +SV CG+CY C RG H+C G+ D G AEY V+ Sbjct: 76 VLEVGRDVKNVRAGDRISVMPLASCGQCYYCVRGMRHLCTKMGCVGLSWDGGGMAEYTVL 135 Query: 132 PAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPIS-GKSVLITGAGPLGLLGIAVAKAS 190 + + P ++ + L EP A+ V G ++ G SVLITGAGP+G+L A+ Sbjct: 136 NDYHANRLPDNVSDKQGALIEPAAVALYAVDRGGVTVGSSVLITGAGPIGVLAALACHAA 195 Query: 191 GAYPVIVSEPSDFRRELAKKVG-ADYVINPFEEDVVKEVMDITDGNGVDVFLEFSGAPKA 249 GA + VSEP+ R + G + +P E ++ + + D+T+G GVDV +E SG A Sbjct: 196 GASQIFVSEPNPARAAKMSEFGVTTQIFDPTEGELPERIRDLTEGVGVDVAIECSGNQHA 255 Query: 250 LEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRHLWETWYTVSRLLQS 309 L + AV AG V GL+ G T+D + K + I G T + W + ++ + Sbjct: 256 LNACVDAVRSAGAVVQAGLHVGTATVDPMKWSL-KDIHIEG-TWCYPVTIWPRIIGMIAN 313 Query: 310 GKLNLDPIITHKYKGFDKYEEAFELM 335 GK ++ +I D + F+ + Sbjct: 314 GKFPVEKLIHDLIDADDVVAKGFDAL 339 Lambda K H 0.318 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 356 Length adjustment: 29 Effective length of query: 319 Effective length of database: 327 Effective search space: 104313 Effective search space used: 104313 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory