Align D-gluconate dehydrogenase cytochrome c subunit (EC 1.1.99.3) (characterized)
to candidate H281DRAFT_03306 H281DRAFT_03306 Cytochrome c, mono- and diheme variants
Query= metacyc::MONOMER-12746 (434 letters) >FitnessBrowser__Burk376:H281DRAFT_03306 Length = 434 Score = 343 bits (880), Expect = 6e-99 Identities = 190/427 (44%), Positives = 251/427 (58%), Gaps = 15/427 (3%) Query: 2 KALVIATLALLGSAA--------ANAAEADQQALVQQGEYLARAGDCVACHTAKDGKPFA 53 K +V+A A+LG+ A A++ ALV +GEYLA+A DC CHTA G+ + Sbjct: 6 KLIVLAGTAMLGAFTTPCVTAEPAGASDPALAALVARGEYLAKASDCAGCHTAVGGQAYG 65 Query: 54 GGLPMETPIGVIYSTNITPDKT-GIGDYSFEDFDKAVRHGVAKGGSTLYPAMPFPSYARV 112 GGL + +P G I S+NITPD+ GIG YS+EDF ++VR GV+ G LYPAMP+ S++++ Sbjct: 66 GGLGLTSPFGTIMSSNITPDRRYGIGAYSYEDFARSVREGVSPGNKRLYPAMPYASFSKM 125 Query: 113 SDADMQALYAYFMKGVAPVARDNQDSDIPWPLSMRWPLSIWRWMFAPSVETPAPAAGSDP 172 SD DM+ALYAYFM GV P + + +P + RW L W+ FAP+ E P AG D Sbjct: 126 SDDDMRALYAYFMHGVKPAPEPAPPTKLAFPFNQRWVLYFWQLAFAPT-EPYRPKAGRDA 184 Query: 173 VISRGAYLVEGLGHCGACHTPRALTMQEKALSASGGSDFLSGSAPLEGWIAKSLRGDHKD 232 +RGA+LV+G GHCGACHTPR QE+ S +L+G + W +L GD Sbjct: 185 QWNRGAFLVQGPGHCGACHTPRGPGFQERGYDESSPM-YLTGGVN-DNWFGPNLTGDPGS 242 Query: 233 GLGSWSEEQLVQFLKTGRSDRSAVFGGMSDVVVHSMQYMTDADLTAIARYLKSLPANDPK 292 GLG E+ L FLKTG FG M + V S QY+TD D A+A Y+KSLPA P Sbjct: 243 GLGRIGEKDLAAFLKTGHGAGLVAFGSMVEQVEDSTQYLTDEDALAMAHYVKSLPAQKPS 302 Query: 293 D--QPH-QYDKQVAQALWNGDDSKPGAAVYIDNCAACHRTDGHGYTRVFPALAGNPVLQS 349 +PH Q D GA VYI CA CH G G VFP LAGNP + + Sbjct: 303 GSYEPHAQPDLPTRNGNRVDAPQSVGARVYISFCARCHGVQGAGMPNVFPRLAGNPSVIT 362 Query: 350 ADATSLIHIVLKGGTLPATHSAPSTFTMPAFAWRLSDQEVADVVNFIRSSWGNQASAVKP 409 D TSLI ++++GG PAT S P MP FA L++ ++A+V+++IR+SWGN A V Sbjct: 363 EDTTSLIRLMVEGGNSPATISGPPRQAMPGFAQTLTNAQMANVLSWIRTSWGNDARPVTA 422 Query: 410 GDVAALR 416 D+ +LR Sbjct: 423 NDIQSLR 429 Lambda K H 0.316 0.131 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 434 Length adjustment: 32 Effective length of query: 402 Effective length of database: 402 Effective search space: 161604 Effective search space used: 161604 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory