Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate H281DRAFT_00163 H281DRAFT_00163 glucokinase /transcriptional regulator, RpiR family
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >lcl|FitnessBrowser__Burk376:H281DRAFT_00163 H281DRAFT_00163 glucokinase /transcriptional regulator, RpiR family Length = 638 Score = 262 bits (670), Expect = 1e-74 Identities = 138/316 (43%), Positives = 191/316 (60%), Gaps = 4/316 (1%) Query: 6 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKV-EVKDGCIAIA 64 L+ D+GGTNAR AL + GEI Y DYP + VI+ YL++ K+ V IAIA Sbjct: 22 LLADIGGTNARFAL-ETGPGEIGSVHVYPCADYPGVAEVIKKYLKDTKIGRVNHAAIAIA 80 Query: 65 CPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEP 124 P+ GD V+MTNH W+FSI ++ LGF L ++NDFTA++MA+P L +Q GG Sbjct: 81 NPVDGDQVSMTNHDWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQVGGGTR 140 Query: 125 VEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHV 184 I + G GTG+GV+ L+ D RW++L EGGH FAP E E I+L+ R + HV Sbjct: 141 RPNSVIGLLGPGTGMGVSGLIPADDRWIALGSEGGHATFAPADEREDIVLQYARKKWSHV 200 Query: 185 SAERVLSGPGLVNLYRAIVKAD-NRLPENLKPKDITERALADSCTDCRRALSLFCVIMGR 243 S ERV +GPG+ +YRA+ D R+ N+ +I +RAL ++ +FC I+G Sbjct: 201 SFERVAAGPGIEVIYRALAGRDKKRVAANVDTVEIVKRALEGEPL-AAESVDVFCGILGT 259 Query: 244 FGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDN 303 F GN+A+ LG GG++I GG+VPR EFF S FR FE KGRF+ Y+ ++P Y+I + Sbjct: 260 FAGNIAVTLGALGGIYIGGGVVPRLGEFFARSSFRKRFEAKGRFEAYLQNVPTYVITAEY 319 Query: 304 PGLLGSGAHLRQTLGH 319 P LG A L + L + Sbjct: 320 PAFLGVSAILAEQLSN 335 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 578 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 638 Length adjustment: 33 Effective length of query: 288 Effective length of database: 605 Effective search space: 174240 Effective search space used: 174240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
Align candidate H281DRAFT_00163 H281DRAFT_00163 (glucokinase /transcriptional regulator, RpiR family)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.18156.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-101 324.5 0.0 5.6e-101 323.9 0.0 1.3 1 lcl|FitnessBrowser__Burk376:H281DRAFT_00163 H281DRAFT_00163 glucokinase /tra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_00163 H281DRAFT_00163 glucokinase /transcriptional regulator, RpiR family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 323.9 0.0 5.6e-101 5.6e-101 1 313 [. 22 324 .. 22 326 .. 0.96 Alignments for each domain: == domain 1 score: 323.9 bits; conditional E-value: 5.6e-101 TIGR00749 1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpikgcfaiatPii 66 l++diGGtnar+al e pgei +v++y + d+p + +v++ yl+++k+ + ++++aia P+ lcl|FitnessBrowser__Burk376:H281DRAFT_00163 22 LLADIGGTNARFAL-ETGPGEIGSVHVYPCADYPGVAEVIKKYLKDTKIGRVN--HAAIAIANPVD 84 79************.*******************************9987777..8********** PP TIGR00749 67 gdfvrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailG 132 gd v +tn+dW++sie +++ l++ l ++ndf+a a+a+++l + + +q+gg +++ i +lG lcl|FitnessBrowser__Burk376:H281DRAFT_00163 85 GDQVSMTNHDWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQVGGGTRRPNSVIGLLG 150 ****************************************************************** PP TIGR00749 133 aGtGlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGlvliy 198 +GtG+Gv+ li+ +d+r+ +l +eGgh+ faP +e e ++l+y+rkk+++vs erv +G+G+ +iy lcl|FitnessBrowser__Burk376:H281DRAFT_00163 151 PGTGMGVSGLIP-ADDRWIALGSEGGHATFAPADEREDIVLQYARKKWSHVSFERVAAGPGIEVIY 215 ************.9**************************************************** PP TIGR00749 199 ealskrkgerevsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklgarGGvy 264 +al r+ +k ++ +i ++aleg+ +la +++++f++ilG++agn+a++lga GG+y lcl|FitnessBrowser__Burk376:H281DRAFT_00163 216 RALAGRD-----KKRVAANVDTVEIVKRALEGE-PLAAESVDVFCGILGTFAGNIAVTLGALGGIY 275 *****99.....33334677788999*****97.788899************************** PP TIGR00749 265 vaGGivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllG 313 + GG+vPr+ e++ +ssfr++fe kGr++++l+++P +v+ + + +lG lcl|FitnessBrowser__Burk376:H281DRAFT_00163 276 IGGGVVPRLGEFFARSSFRKRFEAKGRFEAYLQNVPTYVITAEYPAFLG 324 *****************************************99998887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (638 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 14.23 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory