Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate H281DRAFT_05701 H281DRAFT_05701 glycerol 3-phosphate ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Burk376:H281DRAFT_05701 Length = 362 Score = 323 bits (828), Expect = 5e-93 Identities = 180/378 (47%), Positives = 241/378 (63%), Gaps = 17/378 (4%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M L L + K Y + K + + ++D++D EF+V VGPSGCGKST LRM+AGLE I+EG Sbjct: 1 MAALTLQGVKKTY-DGKQFVLHGIDVDVNDGEFVVMVGPSGCGKSTLLRMVAGLERISEG 59 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 + I K++N+ PKDR+IAMVFQNYALYPHMSV ENM + LK+ + I +RV+ AA Sbjct: 60 TISIAGKVVNELEPKDRNIAMVFQNYALYPHMSVAENMGYALKIAGVDRAQIAQRVNAAA 119 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 +IL L L+RKP +LSGGQRQRVAMGRAIVR+ VFL DEPLSNLDA+LRV MR EI + Sbjct: 120 QILELEPLLQRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDARLRVQMRLEIQR 179 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 +H R+ T++YVTHDQ EAMTLA R+++M+ G EQIG P E+Y PA Sbjct: 180 LHARLATTSLYVTHDQIEAMTLAQRVIVMNK----------GHAEQIGAPTEVYERPATV 229 Query: 241 FVAGFIGSPAMNFFEVTVEKE-RLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGIRPED 299 FVAGFIGSP MN E V + + G LP + + G++ TLGIRPE Sbjct: 230 FVAGFIGSPGMNLLEGRVSDDGSTFDVAGNGPQLPLAGVASIGREVAKGREWTLGIRPEH 289 Query: 300 ISSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEKVQLT 359 +S Q P+ ++T D ELLG++++ + ++G + TAR+ + GE +Q+ Sbjct: 290 MSPGQ---ADAPHTTLTVD--SCELLGADNLAHGRWGKHDVTARLPHAHRPAAGEALQVA 344 Query: 360 FNIAKGHFFDLETEKRIN 377 HFFD + +R+N Sbjct: 345 LPARHLHFFDPASGRRVN 362 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 362 Length adjustment: 30 Effective length of query: 347 Effective length of database: 332 Effective search space: 115204 Effective search space used: 115204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory