Align ABC transporter for D-Trehalose, permease component 2 (characterized)
to candidate H281DRAFT_03745 H281DRAFT_03745 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= reanno::Smeli:SM_b20327 (276 letters) >FitnessBrowser__Burk376:H281DRAFT_03745 Length = 283 Score = 150 bits (378), Expect = 4e-41 Identities = 85/280 (30%), Positives = 153/280 (54%), Gaps = 9/280 (3%) Query: 4 AIAKRTAF-YALVAVIILVAVFPFYYAILTSLKSGTALFRID--YWPTDISLANYAGIFS 60 A AKR+ + + ++ +++V +FPF + T+LK + +F + P +N+ ++ Sbjct: 5 AKAKRSLWCWLALSPLVVVVLFPFAVMLFTALKPASEIFVYPARWLPVHWQWSNFVDMWQ 64 Query: 61 HGTFVRNLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVL 120 F L NS +++ L ++L +++ AAYALAR FRGRG +L M I ++ Sbjct: 65 AANFGVALRNSTVISLLSTLLALAVSLPAAYALARFPFRGRGTYRQFLLVTQMLSPILLV 124 Query: 121 AGLFELIRFV-----GIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGA 175 GLF L + + ++ + +I SY F + F VW+L+++ + +P ++EE+A ++G Sbjct: 125 VGLFRLAAMIPYGDGNLVDSKIGVIVSYAAFNIAFAVWMLSSYFQTVPRDLEESAWLEGC 184 Query: 176 SPWVVITRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQ 235 + +VF+PL PA+V T + FI AWNEF T S +T+ V + + G + Sbjct: 185 GRTKAVFKVFLPLAVPAIVVTAIFTFINAWNEFAVVYTLIRSPENKTLTVQVTDMVAG-K 243 Query: 236 FEIPWGNIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVK 275 + + W +MAA++ T+P+ ++ QR ++ GL G VK Sbjct: 244 YVVEWHLVMAATLCATLPVSIVFAWLQRYLVKGLALGAVK 283 Lambda K H 0.332 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 283 Length adjustment: 26 Effective length of query: 250 Effective length of database: 257 Effective search space: 64250 Effective search space used: 64250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory