Align electron transfer component of the anthranilate 1,2-dioxygenase system (EC 1.14.12.1) (characterized)
to candidate H281DRAFT_04056 H281DRAFT_04056 CDP-4-dehydro-6-deoxyglucose reductase
Query= reanno::WCS417:GFF4631 (335 letters) >FitnessBrowser__Burk376:H281DRAFT_04056 Length = 343 Score = 152 bits (383), Expect = 2e-41 Identities = 108/329 (32%), Positives = 170/329 (51%), Gaps = 18/329 (5%) Query: 17 FPVGANEILLDAALRNGIKIPLDCREGVCGTCQGRCESGDYSQDYVDEEALSSLDLQQRK 76 F V +E +L+AALR GI +P C+ G CG+C+G SG Q ALS+ + + Sbjct: 14 FQVEQDEPVLNAALRQGIGLPYGCKNGACGSCKGAVISGQVEQRAHSSSALSNEEKTRGM 73 Query: 77 MLSCQTRVKSDATFYFDFDSSLCNAPGPVQVKG---TVSAVEQVSASTAILQVQL--DQA 131 L C SD + D G VQVK V+A+E+ + +L++QL ++ Sbjct: 74 ALFCCATACSD----LEIDIREVAGVGDVQVKKLPCRVNAIERKADDVVVLKLQLPANER 129 Query: 132 LDFLPGQYARLSVPGTDSWRSYSFANLP--GNHLQFLVRLLPDGVMSNYLRERCQVGDEL 189 L +L GQY + RSYS AN P ++ +R +P G ++++ + D L Sbjct: 130 LQYLAGQYLEF-ILKDGKRRSYSMANAPHVEGPIELHIRHMPGGAFTDHVFNAMKERDIL 188 Query: 190 LMEAPLGAFYLRHVT-QPLVLVAGGTGLSALLGMLDQLAANGCEQPVHLYYGVRGAEDLC 248 EAPLG F+LR + +P+VL+A GTG + L +++ +P+ LY+G R +DL Sbjct: 189 RFEAPLGTFFLREESDKPIVLLASGTGFAPLKAIVEHAVFKNLNRPMTLYWGARRKKDLY 248 Query: 249 EAARIRAYAAKIPNLRYTEVLSA--PSEEWSGKRGYLTEHFDLAELRDGSA-DMYLCGPP 305 +A +IPN ++ VLS PS+ W+G+ G++ + +L D SA +Y CG P Sbjct: 249 LLELAEQWAREIPNFKFVPVLSEPDPSDAWTGRVGFV-HRAVIEDLPDLSAYQVYACGAP 307 Query: 306 PMVESIQQ-WLADQALDGVQLYYEKFTQS 333 MVES Q+ + +L + Y + FT + Sbjct: 308 VMVESAQRDFTQHHSLPEDEFYADSFTSA 336 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 343 Length adjustment: 28 Effective length of query: 307 Effective length of database: 315 Effective search space: 96705 Effective search space used: 96705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory