Align Catechol 1,2-dioxygenase; EC 1.13.11.1 (characterized)
to candidate H281DRAFT_02578 H281DRAFT_02578 hydroxyquinol 1,2-dioxygenase
Query= SwissProt::P86029 (303 letters) >FitnessBrowser__Burk376:H281DRAFT_02578 Length = 288 Score = 178 bits (451), Expect = 2e-49 Identities = 91/248 (36%), Positives = 140/248 (56%), Gaps = 3/248 (1%) Query: 6 TESVKTSLGPNATPRAKKLIASLVQHVHDFARENHLTTEDWLWGVDFINRIGQMSDSRRN 65 T +V L + + R ++ +LV+H+H F +E T ++W + F+ + GQM R Sbjct: 10 TAAVIERLAGSTSKRVHQISDALVRHLHAFVKEIEPTEDEWAAAIRFLTQTGQMCTDTRQ 69 Query: 66 EGILVCDIIGLETLVDALTNESEQSNHTSSAILGPFYLPDSPVYPNGGSIVQKAIPTDVK 125 E IL+ D +G+ LVDA+ N + T + +LGPFY+ ++ P G SI + Sbjct: 70 EFILLSDTLGVSMLVDAI-NHRYPGDATQTTVLGPFYVEEAAELPLGASIADGEPGEPL- 127 Query: 126 CFVRGKVTDTEGKPLGGAQLEVWQCNSAGFYSQQADHDGPEFNLRGTFITDDEGNYSFEC 185 V G V D GKP+ GA +E W +S GFY Q E ++R F+TD +G + + Sbjct: 128 -LVEGTVRDLNGKPIAGALVETWHADSHGFYDVQKAAGKTELHMRARFLTDADGAFWYRS 186 Query: 186 LRPTSYPIPYDGPAGDLLKIMDRHPNRPSHIHWRVSHPGYHTLITQIYDAECPYTNNDSV 245 + P +YPIP DGP G +L RHP RP+H+H+RVS PG+ TL+T ++ + Y ++D V Sbjct: 187 IVPAAYPIPNDGPVGRMLDAQGRHPYRPAHVHFRVSAPGFETLVTHVFVSGDVYLDSDVV 246 Query: 246 YAVKDDII 253 + VKD +I Sbjct: 247 FGVKDALI 254 Lambda K H 0.316 0.134 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 288 Length adjustment: 26 Effective length of query: 277 Effective length of database: 262 Effective search space: 72574 Effective search space used: 72574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory