Align Kynurenine formamidase, bacterial (EC 3.5.1.9) (characterized)
to candidate H281DRAFT_04142 H281DRAFT_04142 Kynurenine formamidase
Query= reanno::BFirm:BPHYT_RS16025 (212 letters) >FitnessBrowser__Burk376:H281DRAFT_04142 Length = 212 Score = 398 bits (1022), Expect = e-116 Identities = 192/211 (90%), Positives = 198/211 (93%) Query: 1 MPTLWDITPAVDTATPVWPGDTPVGIERVWRMEAGSPVNVARLTLSPHTGAHTDAPLHYD 60 M TLWDITPAVDTATPVWPGDTPVGIERVWR+EAGSPVNVARLTLSPHTGAHTDAPLHYD Sbjct: 1 MQTLWDITPAVDTATPVWPGDTPVGIERVWRIEAGSPVNVARLTLSPHTGAHTDAPLHYD 60 Query: 61 AEGVAIGEVPLDAYLGRCRVIHCIGASPVVTPQHLSGSLDDLPPRVLLRTYRNAPTAAWD 120 A G AIG VPLD YLGRCRVIHCIGASPVVTPQHL G DLPPRVLLRTYRNAPTAAWD Sbjct: 61 AAGAAIGHVPLDIYLGRCRVIHCIGASPVVTPQHLDGLQGDLPPRVLLRTYRNAPTAAWD 120 Query: 121 SAFCAVAPDTIDLLAARGVKLIGIDTPSLDPQESKTMDAHHRIRTHRMAILEGIVLDDVA 180 S FCAVAP+TIDLLAA GVKLIGIDTPSLDPQESKTMDAHHR+R H MAILEGIVLDDVA Sbjct: 121 SGFCAVAPETIDLLAANGVKLIGIDTPSLDPQESKTMDAHHRVRAHGMAILEGIVLDDVA 180 Query: 181 PGDYELIALPLKLTTLDASPVRAILRALPES 211 PGDYELIALPLKLTTLDASPVRA+LRALP++ Sbjct: 181 PGDYELIALPLKLTTLDASPVRAVLRALPDA 211 Lambda K H 0.320 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 212 Length adjustment: 21 Effective length of query: 191 Effective length of database: 191 Effective search space: 36481 Effective search space used: 36481 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate H281DRAFT_04142 H281DRAFT_04142 (Kynurenine formamidase)
to HMM TIGR03035 (kynB: arylformamidase (EC 3.5.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03035.hmm # target sequence database: /tmp/gapView.16517.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03035 [M=206] Accession: TIGR03035 Description: trp_arylform: arylformamidase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-101 323.5 0.0 3.7e-101 323.4 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_04142 H281DRAFT_04142 Kynurenine forma Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_04142 H281DRAFT_04142 Kynurenine formamidase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 323.4 0.0 3.7e-101 3.7e-101 2 206 .] 4 208 .. 3 208 .. 0.99 Alignments for each domain: == domain 1 score: 323.4 bits; conditional E-value: 3.7e-101 TIGR03035 2 lidisqplnedlatwPGdtpfsqelavsleeegsvnvgritlsvhtGahvdaPlhykndgakigdv 67 l+di++++++++++wPGdtp+ +e+++++e+ ++vnv+r+tls+htGah daPlhy++ ga+ig+v lcl|FitnessBrowser__Burk376:H281DRAFT_04142 4 LWDITPAVDTATPVWPGDTPVGIERVWRIEAGSPVNVARLTLSPHTGAHTDAPLHYDAAGAAIGHV 69 8***************************************************************** PP TIGR03035 68 eldvylGpcrvidclsalekiekealksaleeapervllrtaekakaeafdediaavapdtiella 133 +ld+ylG+crvi+c++a + +++++l + ++p+rvllrt+++a++ a+d+ ++avap+ti+lla lcl|FitnessBrowser__Burk376:H281DRAFT_04142 70 PLDIYLGRCRVIHCIGASPVVTPQHLDGLQGDLPPRVLLRTYRNAPTAAWDSGFCAVAPETIDLLA 135 ****************************************************************** PP TIGR03035 134 ekGvrliGvdtpsvdPleskeldahhalakhdlailenlvldevaeGdyelialPlklaeldaspv 199 ++Gv+liG+dtps+dP+esk++dahh++++h++aile++vld+va GdyelialPlkl++ldaspv lcl|FitnessBrowser__Burk376:H281DRAFT_04142 136 ANGVKLIGIDTPSLDPQESKTMDAHHRVRAHGMAILEGIVLDDVAPGDYELIALPLKLTTLDASPV 201 ****************************************************************** PP TIGR03035 200 ravlral 206 ravlral lcl|FitnessBrowser__Burk376:H281DRAFT_04142 202 RAVLRAL 208 *****86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (206 nodes) Target sequences: 1 (212 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 5.91 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory