Align 2-oxopent-4-enoate hydratase (EC 4.2.1.80) (characterized)
to candidate H281DRAFT_01664 H281DRAFT_01664 2-oxo-3-hexenedioate decarboxylase
Query= BRENDA::P77608 (269 letters) >FitnessBrowser__Burk376:H281DRAFT_01664 Length = 255 Score = 112 bits (280), Expect = 8e-30 Identities = 71/220 (32%), Positives = 110/220 (50%), Gaps = 3/220 (1%) Query: 36 EAAYAIQHINVQHDVAQGRRVVGRKVGLTHPKVQQQLGVDQPDFGTLFADMCYGDNEIIP 95 + AY IQ +++ + +G R VG K+G T Q+G+ +G L M + I Sbjct: 33 DEAYRIQAESIRRRLDRGERRVGVKMGFTSRAKMVQMGLSDVIWGRLTDAMQIEEGTAID 92 Query: 96 FSRVLQPRIEAEIALVLNRDLPATDITFDELYNAIEWVLPALEVVGSRIRDWSIQFVDTV 155 SR + R E EIA +L R L ++T + A+E + PA+E++ SR +D+ + + Sbjct: 93 LSRFIHARCEPEIAFILKRPLEG-NVTGPQALAAVEAIAPAIEIIDSRYKDFKFSLPEVI 151 Query: 156 ADNASCGVYVIGGPAQRPAGLDLKNCAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKM 215 ADNAS +VIG A +D N + ++ + V G + LGHPL + V AR Sbjct: 152 ADNASSSGFVIG--AWCDPKIDFSNLGLTVSIDGRVVQVGSTAALLGHPLRSLVAAARLS 209 Query: 216 ASLGEPLRTGDIILTGALGPMVAVNAGDRFEAHIEGIGSV 255 A GEPL+ G I++ G P + G +E +GSV Sbjct: 210 AEAGEPLQAGWIVMAGGATPAEWIKLGQYTSVDMEQLGSV 249 Lambda K H 0.319 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 255 Length adjustment: 25 Effective length of query: 244 Effective length of database: 230 Effective search space: 56120 Effective search space used: 56120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory