Align Metapyrocatechase 2; MPC; EC 1.13.11.2; CatO2ase; Catechol 2,3-dioxygenase II (uncharacterized)
to candidate H281DRAFT_00703 H281DRAFT_00703 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein
Query= curated2:P17296 (320 letters) >FitnessBrowser__Burk376:H281DRAFT_00703 Length = 356 Score = 115 bits (287), Expect = 2e-30 Identities = 95/315 (30%), Positives = 132/315 (41%), Gaps = 19/315 (6%) Query: 17 ARPRHAVHSIDHYALEVPDLAVAERFLDAFGLTVARTPECLEVYAADQRCWARFYEGERK 76 A P ++ + LE PDL AERFL+ FGL E L + + + + Sbjct: 12 ANPTAKATALSYLMLERPDLEQAERFLNDFGLLTVSRDEALLLLRGTGASHFCYAVRKAQ 71 Query: 77 RLAYLSFSCFEGDFAGIRQQLAASGATLVE-DPRYGDESGVWFFDPDGNLVQVKIGPKTS 135 + + F G A + GA+ V+ G V DP G V G S Sbjct: 72 KARFAGFGLQVGSLAELDALANLPGASQVQASALVGGGYVVQLTDPSGFRVDAIWGQ--S 129 Query: 136 PSSKSPARLEGAPGGQRGAVVRSQVQRVLPR-----RLSHVLLFTPSVQRALDFYRDALG 190 P+ P R + AV + QR + RL HV+L Q +Y G Sbjct: 130 PAEALPHRQPLSFNSVDAAVRINDTQRPPEQPPEVIRLGHVVLELADYQETCAWYTRHFG 189 Query: 191 LRLSD-----RSDDVIAFTHAPYG---SDHHLLALVKSSARGWHHAAWDVADVNEVGQGA 242 L SD +AF G +DHH LAL + + H+A++V D + VG G Sbjct: 190 LIPSDIQVLPDGSPAVAFLRLDLGDEPADHHTLALAQGFVATYSHSAYEVVDADAVGMGQ 249 Query: 243 SQMAKAGYTQGWGTGRHVLGSNYFFYVLDPWGSFCEYSADIDYIPAGQAWPAGDFA-AED 301 + G+T WG GRH+LGS F Y DPWG E+ D D + A P G A + + Sbjct: 250 RVLRDKGWTHAWGIGRHILGSQIFDYWQDPWGDKHEHYCDGDLFTS--AAPTGIHAVSRE 307 Query: 302 SLYQWGPDVPEYFVR 316 ++ QWGP +P F R Sbjct: 308 AMAQWGPTMPRSFTR 322 Lambda K H 0.320 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 356 Length adjustment: 28 Effective length of query: 292 Effective length of database: 328 Effective search space: 95776 Effective search space used: 95776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory