GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HPD in Paraburkholderia bryophila 376MFSha3.1

Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate H281DRAFT_05849 H281DRAFT_05849 4-hydroxyphenylpyruvate dioxygenase

Query= reanno::pseudo6_N2E2:Pf6N2E2_456
         (358 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_05849 H281DRAFT_05849
           4-hydroxyphenylpyruvate dioxygenase
          Length = 365

 Score =  418 bits (1074), Expect = e-121
 Identities = 211/361 (58%), Positives = 268/361 (74%), Gaps = 15/361 (4%)

Query: 5   YENPMGLMGFEFIEFASPTPNTLEPIFEIMGFTKVATHRSKDVHLYRQGAINLILNNEPH 64
           +ENP+G  GFEFIE+ +P P  L  +FE MGFT VA HR KDV LYRQG IN I+N EP 
Sbjct: 6   WENPVGTDGFEFIEYTAPDPKALGKLFEQMGFTAVARHRHKDVTLYRQGDINFIVNGEPD 65

Query: 65  SVASYFAAEHGPSVCGMAFRVKDSQKAYKRALELGAQPIHIETGPMELNLPAIKGIGGAP 124
           S A  FA  HGPS+C +AFRV+D+ KAY++A+E GA     +TGPMELN+PAIKGIG + 
Sbjct: 66  SFAQRFARLHGPSICAIAFRVQDAGKAYRQAVEKGAWGFDNKTGPMELNIPAIKGIGDSL 125

Query: 125 LYLIDRF------GEGS----SIYDIDFVFIEGVDRNPVGAGLKIIDHLTHNVYRGRMAY 174
           +Y +DR+        GS     IYD+DF  I G + NPVG GL  IDHLTHNV+RGRM  
Sbjct: 126 IYFVDRWRGKNGAAPGSVGDIDIYDVDFEPIPGANPNPVGHGLTYIDHLTHNVHRGRMQE 185

Query: 175 WAGFYEKLFNFREIRYFDIKGEYTGLTSKAMTAPDGMIRIPLNEESSKGAGQIEEFLMQF 234
           WA FYE+LFNFRE+RYFDI+G+ TG+ SKAMT+P G IRIP+NEE S+ +GQI+E+L  +
Sbjct: 186 WAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGKIRIPINEEGSETSGQIQEYLDAY 245

Query: 235 NGEGIQHVAFLTDDLVKTWDHLKSIGMRFMTAPPDTYYEMLEGRLPNHGEPVDELQSRGI 294
            GEGIQH+A  ++D+ +T D L++  +  +    DTYYE+++ R+PNHGEP+DEL+ R I
Sbjct: 246 RGEGIQHIALGSNDIYRTVDGLRAANISLLDT-IDTYYELVDRRVPNHGEPLDELRKRKI 304

Query: 295 LLDGASEQGDKRLLLQIFSETLMGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGV 354
           L+DGA +     LLLQIF+E  +GP+FFE IQRKG+ GFGEGNFKALFESIE DQ+RRGV
Sbjct: 305 LIDGAPDD----LLLQIFTENQIGPIFFEIIQRKGNQGFGEGNFKALFESIELDQIRRGV 360

Query: 355 L 355
           +
Sbjct: 361 V 361


Lambda     K      H
   0.321    0.141    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 546
Number of extensions: 29
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 358
Length of database: 365
Length adjustment: 29
Effective length of query: 329
Effective length of database: 336
Effective search space:   110544
Effective search space used:   110544
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate H281DRAFT_05849 H281DRAFT_05849 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01263.hmm
# target sequence database:        /tmp/gapView.20714.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01263  [M=353]
Accession:   TIGR01263
Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
   7.9e-124  399.6   0.0   9.7e-124  399.3   0.0    1.1  1  lcl|FitnessBrowser__Burk376:H281DRAFT_05849  H281DRAFT_05849 4-hydroxyphenylp


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_05849  H281DRAFT_05849 4-hydroxyphenylpyruvate dioxygenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  399.3   0.0  9.7e-124  9.7e-124       2     352 ..      14     360 ..      13     361 .. 0.93

  Alignments for each domain:
  == domain 1  score: 399.3 bits;  conditional E-value: 9.7e-124
                                    TIGR01263   2 gfdfvefavgdakqaakalveklGfeavaketgsrekastvlrqgeitlvltaelsssseaaafla 67 
                                                  gf+f+e++++d+k a+ +l+e++Gf+ava+   +r+k++t++rqg+i+++++ e+ s   a++f++
  lcl|FitnessBrowser__Burk376:H281DRAFT_05849  14 GFEFIEYTAPDPK-ALGKLFEQMGFTAVAR---HRHKDVTLYRQGDINFIVNGEPDSF--AQRFAR 73 
                                                  8************.***************8...*********************9999..****** PP

                                    TIGR01263  68 kHGdgvkdvafevedveaafeaavergaeavsapeeedekevklaaikgiGdvvltlveregekgs 133
                                                   HG++++++af+v+d+ +a+++ave+ga  +++++    +e++++aikgiGd+++++v+r + k+ 
  lcl|FitnessBrowser__Burk376:H281DRAFT_05849  74 LHGPSICAIAFRVQDAGKAYRQAVEKGAWGFDNKTG--PMELNIPAIKGIGDSLIYFVDRWRGKNG 137
                                                  *******************************99986..99*******************9887666 PP

                                    TIGR01263 134 ilpg........feevsekaalkekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfd 191
                                                    pg        +++++    ++ ++ + gl++iDH+++nv+rg+++++aefye++++f+e+++fd
  lcl|FitnessBrowser__Burk376:H281DRAFT_05849 138 AAPGsvgdidiyDVDFEPIPGANPNPVGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFD 203
                                                  5554111111112334444456777899************************************** PP

                                    TIGR01263 192 ikteasaLkSkvlasaegkvklplnepaskkkksQIeeyleeyeGaGvQHlAlntedivktveelr 257
                                                  i+++++++kSk+++s++gk+++p+ne + ++ ++QI+eyl++y G+G+QH+Al ++di++tv+ lr
  lcl|FitnessBrowser__Burk376:H281DRAFT_05849 204 IEGKVTGVKSKAMTSPCGKIRIPINE-EGSETSGQIQEYLDAYRGEGIQHIALGSNDIYRTVDGLR 268
                                                  **************************.78899********************************** PP

                                    TIGR01263 258 argveflkipetYYdnlkervkklvkedleelkelkiLvDrdeeGlLLQiFtkpvvdrgtlFfEiI 323
                                                  a  + +l++ +tYY+ +++rv++ + e+l+el+++kiL+D++ + lLLQiFt++ +  g++FfEiI
  lcl|FitnessBrowser__Burk376:H281DRAFT_05849 269 AANISLLDTIDTYYELVDRRVPN-HGEPLDELRKRKILIDGAPDDLLLQIFTENQI--GPIFFEII 331
                                                  **********************7.********************************..******** PP

                                    TIGR01263 324 qRkgakGFGegNfkaLfeaiEreqekrgv 352
                                                  qRkg++GFGegNfkaLfe+iE +q++rgv
  lcl|FitnessBrowser__Burk376:H281DRAFT_05849 332 QRKGNQGFGEGNFKALFESIELDQIRRGV 360
                                                  ***************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (353 nodes)
Target sequences:                          1  (365 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.84
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory