GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aacS in Paraburkholderia bryophila 376MFSha3.1

Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate H281DRAFT_04125 H281DRAFT_04125 Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II

Query= reanno::acidovorax_3H11:Ac3H11_3009
         (578 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_04125 H281DRAFT_04125
           Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
          Length = 520

 Score =  217 bits (552), Expect = 1e-60
 Identities = 178/563 (31%), Positives = 267/563 (47%), Gaps = 63/563 (11%)

Query: 16  SHARGATDVPLIEQTIGAFFADMVA----RQPEREALVSVHQGRRYTYAQLQTEAHRLAS 71
           S  R   DVP +   + A  +D+ A    R P+  AL+    GRR T AQL       A+
Sbjct: 5   SPLRSRIDVPALLAALPARISDIPALAAGRDPQHVALIE--DGRRLTNAQLVQAVEATAA 62

Query: 72  ALLGMGLTPGDRVGIWSHNNAEWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKL 131
            L   G+  GDRV I + N+   +++  ATA                       ++    
Sbjct: 63  LLRDWGVRGGDRVMIVAENSIAQIVLLFATA-----------------------RLDAWA 99

Query: 132 LVSMARFKTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKT-VVWIDDEAGQGADEPGLL 190
           LVS AR   S+ L  +R            H Q    P++   VV    +AGQ A   G  
Sbjct: 100 LVSNARLSASE-LDAIR-----------AHAQ----PRVTAYVVESSADAGQHAQRHGAS 143

Query: 191 RFTELIARGNAADPRLAQVAAGLQATDPIN------IQFTSGTTGFPKGATLTHRNILNN 244
              + +A G  A        A  +  +  N      + +T+GTTG PKG  L+HRN+L  
Sbjct: 144 AAPD-VAPGIGAWSFTVDTFAQAEPVEAANDRQCAALIYTTGTTGAPKGVMLSHRNLLFI 202

Query: 245 GFFIGECMKLTPADRLCIPVPLYHCFGMVLGNLACFTHGATI-VYPNDGFDPLTVLQTVQ 303
                   ++ P D +   +P+ H +G     L     GAT+ + P   F P  V + + 
Sbjct: 203 AAVSSRLRQVRPDDVVYAVLPISHVYGFASVCLGSLYAGATLRLAPR--FAPGAVRRALA 260

Query: 304 DERCTGLHGVPTMFIAELDHPRFA--EFNLSTLRTGIMAGSPCPTEVMKRVVEQMNLREI 361
           DER +   GVP M    ++H +     ++   LR     GSP     +K  VE +    +
Sbjct: 261 DERVSIFQGVPAMHAKLIEHLQTHGHAWHAPHLRFIYSGGSPLDA-ALKAHVESVYGLPL 319

Query: 362 TIAYGMTETSPVSCQSSTDTPLSKRVSTVGQVQPHLEVKIVDPDTGAVVPIGQRGEFCTK 421
              YGMTE+SP   Q+  D P  +R  +VG+V P +EV+ V  D GA V +G+ GE   +
Sbjct: 320 HNGYGMTESSPTVSQTMLDAP--RRDCSVGEVIPGVEVRFVGLD-GADVAVGETGELWVR 376

Query: 422 GYSVMHGYWGDEAKTREAIDEGGWMHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPRE 481
           G +VM GY+ +  +TR A+ + GW+ TGDLA  DA+G ++IVGR KD++IR G N+YP E
Sbjct: 377 GPNVMLGYYRNPQQTRAAVTQDGWLKTGDLARQDADGALHIVGRSKDLIIRSGFNVYPAE 436

Query: 482 IEEFLYRHPQVQDVQVVGVPDQKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPR 541
           +E  L  HPQV    V+G P +   EE+ A++        T  ++ A+C  ++A YK P 
Sbjct: 437 VEHVLNAHPQVVQSAVIGRPVEG-NEEVIAFVELAANASVTPAELTAWCVERLAPYKRPA 495

Query: 542 YIRFVTSFPMTVTGKIQKFKIRD 564
            ++ + + P   TGKI K ++R+
Sbjct: 496 EVKVLAALPAASTGKILKHRLRE 518


Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 652
Number of extensions: 33
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 578
Length of database: 520
Length adjustment: 36
Effective length of query: 542
Effective length of database: 484
Effective search space:   262328
Effective search space used:   262328
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory