GapMind for catabolism of small carbon sources

 

Aligments for a candidate for hmgA in Paraburkholderia bryophila 376MFSha3.1

Align Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (characterized)
to candidate H281DRAFT_04741 H281DRAFT_04741 homogentisate 1,2-dioxygenase

Query= reanno::Cup4G11:RR42_RS31275
         (449 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_04741 H281DRAFT_04741
           homogentisate 1,2-dioxygenase
          Length = 448

 Score =  723 bits (1865), Expect = 0.0
 Identities = 339/430 (78%), Positives = 377/430 (87%), Gaps = 1/430 (0%)

Query: 21  PGYQSGFANEFATEALPGALPVGQNSPQRAPYGLYAEQISGTAFTAPRAHNRRSWCYRIR 80
           PGYQSGF NEFATEALPGALP G+NSPQRA YGLYAEQ+SGTAFTAPR HNRR+W YRIR
Sbjct: 19  PGYQSGFGNEFATEALPGALPEGRNSPQRAAYGLYAEQLSGTAFTAPRGHNRRTWLYRIR 78

Query: 81  AAAMHEPFTRVEQSRIVSHFDAVPPSP-NQMRWSPPAMPKEPTDFVDGIITMAGNGGPEA 139
            AA+H+PFT +   R+V++F  VPP+P NQ+RW    MP EPTDFVDG +TMAGNG  ++
Sbjct: 79  PAAVHKPFTPLPSERLVANFAEVPPTPPNQLRWDALPMPGEPTDFVDGWVTMAGNGAADS 138

Query: 140 MSGCGIHLYLANRSMTDRFFYNADGEMLIVPQQGRLRLATEMGLLDVEPQEIVVIPRGVR 199
           MSGC IHLY ANRSMTDRFFY+ADGE+LIVPQ+GRL +ATE+G L+V P EI VIPRGVR
Sbjct: 139 MSGCAIHLYAANRSMTDRFFYSADGELLIVPQEGRLDIATELGRLEVRPFEIAVIPRGVR 198

Query: 200 FRVELPDGEARGYICENYGALFRLPDLGVIGSNGLANPRDFLTPHAWYEDREGDFELVAK 259
           F V LPDG ARGYICEN+GAL RLPDLG IGSNGLANPRDFLTPHA YEDREGDFELVAK
Sbjct: 199 FAVSLPDGTARGYICENFGALLRLPDLGPIGSNGLANPRDFLTPHAAYEDREGDFELVAK 258

Query: 260 FQGNLWRAAIGHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSPSDTP 319
             GNLWRA IGHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFLVLQS SDTP
Sbjct: 259 MNGNLWRADIGHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSQSDTP 318

Query: 320 GVDSIDFVIFGPRWLAMQNTFRPPWFHRNIASEFMGLIEGVYDAKADGFSPGGASLHNCM 379
           GVDS+DFVIF PRWLA ++TFRPPWFHRN+ASEFMGL+ GVYDAKA+GF PGGASLHNCM
Sbjct: 319 GVDSLDFVIFPPRWLAAEDTFRPPWFHRNVASEFMGLVHGVYDAKAEGFVPGGASLHNCM 378

Query: 380 SGHGPDAETFAKATAADTSQPHRIGDTMAFMFETPAVIRPTPYAAESAQLQDDYYRCWQG 439
           SGHGPDA+TF KA+ +DTS+P ++GDTMAFMFET  +I+PT +A E+AQLQ  YY CWQG
Sbjct: 379 SGHGPDADTFEKASHSDTSKPVKVGDTMAFMFETRTLIKPTRFALETAQLQAHYYECWQG 438

Query: 440 LKKHFNPNER 449
           LKKHFNP +R
Sbjct: 439 LKKHFNPEQR 448


Lambda     K      H
   0.320    0.138    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 852
Number of extensions: 33
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 449
Length of database: 448
Length adjustment: 33
Effective length of query: 416
Effective length of database: 415
Effective search space:   172640
Effective search space used:   172640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate H281DRAFT_04741 H281DRAFT_04741 (homogentisate 1,2-dioxygenase)
to HMM TIGR01015 (hmgA: homogentisate 1,2-dioxygenase (EC 1.13.11.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01015.hmm
# target sequence database:        /tmp/gapView.2203.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01015  [M=429]
Accession:   TIGR01015
Description: hmgA: homogentisate 1,2-dioxygenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
   5.8e-207  673.5   0.0   6.7e-207  673.3   0.0    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_04741  H281DRAFT_04741 homogentisate 1,


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_04741  H281DRAFT_04741 homogentisate 1,2-dioxygenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  673.3   0.0  6.7e-207  6.7e-207       3     429 .]      20     443 ..      18     443 .. 0.98

  Alignments for each domain:
  == domain 1  score: 673.3 bits;  conditional E-value: 6.7e-207
                                    TIGR01015   3 kylsGfgnefeseavpgalPvGqnsPqkapyglyaeqlsGsaftaPraenkrswlyrirPsaahea 68 
                                                   y+sGfgnef++ea+pgalP+G+nsPq+a+yglyaeqlsG+aftaPr +n+r+wlyrirP+a h++
  lcl|FitnessBrowser__Burk376:H281DRAFT_04741  20 GYQSGFGNEFATEALPGALPEGRNSPQRAAYGLYAEQLSGTAFTAPRGHNRRTWLYRIRPAAVHKP 85 
                                                  6***************************************************************** PP

                                    TIGR01015  69 feelkeseekltanfkeeas.dpnqlrwspleipseeavdfveglvtlagagdaksraGlavhlya 133
                                                  f++l   +e l+anf e+++  pnqlrw+ l++p+ e +dfv+g vt+ag+g a s +G a+hlya
  lcl|FitnessBrowser__Burk376:H281DRAFT_04741  86 FTPLP--SERLVANFAEVPPtPPNQLRWDALPMPG-EPTDFVDGWVTMAGNGAADSMSGCAIHLYA 148
                                                  ***99..6889999999988689***********7.99**************************** PP

                                    TIGR01015 134 vnasmedevfynadGdllivpqkGaleittelGrlkvePneiaviprGvrfrveve.eearGyile 198
                                                  +n sm+d+ fy+adG+llivpq+G l+i telGrl+v+P eiaviprGvrf+v++  + arGyi+e
  lcl|FitnessBrowser__Burk376:H281DRAFT_04741 149 ANRSMTDRFFYSADGELLIVPQEGRLDIATELGRLEVRPFEIAVIPRGVRFAVSLPdGTARGYICE 214
                                                  *******************************************************9889******* PP

                                    TIGR01015 199 vygakfqlPdlGPiGanglanprdfeaPvaafedkevkdevrviskfqgklfaakqdhspldvvaw 264
                                                  ++ga  +lPdlGPiG+nglanprdf +P aa+ed+e+  +++++ k +g+l+ a ++hspldvvaw
  lcl|FitnessBrowser__Burk376:H281DRAFT_04741 215 NFGALLRLPDLGPIGSNGLANPRDFLTPHAAYEDREG--DFELVAKMNGNLWRADIGHSPLDVVAW 278
                                                  *************************************..9************************** PP

                                    TIGR01015 265 hGnyvPykydlkkfnvinsvsfdhpdPsiftvltapsdkeGtaiadfvifpPrwlvaektfrPPyy 330
                                                  hGny+Pykydl++fn+i+s+sfdhpdPsif vl ++sd++G+   dfvifpPrwl ae+tfrPP++
  lcl|FitnessBrowser__Burk376:H281DRAFT_04741 279 HGNYAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSQSDTPGVDSLDFVIFPPRWLAAEDTFRPPWF 344
                                                  ****************************************************************** PP

                                    TIGR01015 331 hrnvmsefmGlikGkydakeeGfvpgGaslhnimsahGPdveafekasnael.kPekiddgtlafm 395
                                                  hrnv sefmGl++G ydak+eGfvpgGaslhn+ms hGPd+++fekas+++  kP k++d t+afm
  lcl|FitnessBrowser__Burk376:H281DRAFT_04741 345 HRNVASEFMGLVHGVYDAKAEGFVPGGASLHNCMSGHGPDADTFEKASHSDTsKPVKVGD-TMAFM 409
                                                  ************************************************998549******.***** PP

                                    TIGR01015 396 fesslslavtklakelekldedyeevwqglkkkf 429
                                                  fe++  ++ t++a e+++l+++y+e+wqglkk+f
  lcl|FitnessBrowser__Burk376:H281DRAFT_04741 410 FETRTLIKPTRFALETAQLQAHYYECWQGLKKHF 443
                                                  *********************************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (429 nodes)
Target sequences:                          1  (448 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.02
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory