Align isobutyryl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate H281DRAFT_01204 H281DRAFT_01204 hypothetical protein
Query= reanno::pseudo3_N2E3:AO353_25670 (383 letters) >FitnessBrowser__Burk376:H281DRAFT_01204 Length = 377 Score = 550 bits (1418), Expect = e-161 Identities = 267/372 (71%), Positives = 323/372 (86%) Query: 7 TEEQVMIRDMARDFARGEIAPHAQAWEKAGWIDDALVAKMGELGLLGMVVPEEWGGTYVD 66 TEEQ MIRD ARDFA +AP+A W++ + +V +MG+LG LGM+VP +WGG+Y D Sbjct: 6 TEEQRMIRDAARDFATERLAPNAAQWDRDAQLPADVVRQMGDLGFLGMIVPSQWGGSYTD 65 Query: 67 YVAYALAVEEISAGDGATGALMSIHNSVGCGPVLNYGTEEQKQTWLADLASGQAIGCFCL 126 YVAYALA+EEI+AG A LMS+HNSVGCGP+LN+G++ QK +L DLA+G+ IG FCL Sbjct: 66 YVAYALALEEIAAGCAACATLMSVHNSVGCGPILNFGSDAQKDRYLHDLATGRRIGAFCL 125 Query: 127 TEPQAGSEAHNLRTRAELRDGQWVINGAKQFVSNGRRAKLAIVFAVTDPDLGKKGLSAFL 186 TEPQAGSEA+NLRTRA L DG+W++NG+KQFV+NG RA +AIVFAVTDPD GK+GLSAF+ Sbjct: 126 TEPQAGSEANNLRTRAVLCDGKWILNGSKQFVTNGARADIAIVFAVTDPDRGKRGLSAFI 185 Query: 187 VPTDTPGFIVDRSEHKMGIRASDTCAVTLNNCTIPEANLLGERGKGLAIALSNLEGGRIG 246 VPTDTPGF V + EHK+GIRASDTC ++L++C +P+ANLLGE G+GL IALSNLEGGRIG Sbjct: 186 VPTDTPGFNVGKPEHKLGIRASDTCPISLDDCAVPDANLLGEPGEGLRIALSNLEGGRIG 245 Query: 247 IAAQALGIARAAFEAALAYARDRVQFDKPIIEHQSVANMLADMHTRLNAARLLILHAARL 306 IAAQA+GIARAAF+AA AYA +R+QF K + +HQ++ANMLADM TRLNAARLL+ HAARL Sbjct: 246 IAAQAVGIARAAFDAARAYASERMQFGKALKDHQTIANMLADMATRLNAARLLVHHAARL 305 Query: 307 RSAGKPCLSEASQAKLFASEMAEKVCSSAIQIHGGYGYLEDYPVERYYRDARITQIYEGS 366 RSAG+PCLSEASQAKLFASE+AE+VCS+AIQIHGGYGYLEDY VER+YRDARITQIYEG+ Sbjct: 306 RSAGEPCLSEASQAKLFASEVAEEVCSNAIQIHGGYGYLEDYAVERHYRDARITQIYEGT 365 Query: 367 SEIQRMVIAREL 378 SE+QRMVIAR + Sbjct: 366 SEVQRMVIARHV 377 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 377 Length adjustment: 30 Effective length of query: 353 Effective length of database: 347 Effective search space: 122491 Effective search space used: 122491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory