Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate H281DRAFT_01199 H281DRAFT_01199 Enoyl-CoA hydratase/carnithine racemase
Query= reanno::Cup4G11:RR42_RS28545 (384 letters) >FitnessBrowser__Burk376:H281DRAFT_01199 Length = 386 Score = 324 bits (830), Expect = 3e-93 Identities = 180/365 (49%), Positives = 227/365 (62%), Gaps = 5/365 (1%) Query: 19 ADDEVRFDEINGIGLITLNRPRQLNALSYPMIGLLDAQLAAWAARDDIAAVVLRGAGPKA 78 A E++F IN + +ITLNRP LNALS+ MI L + D I A+ L+GAG K Sbjct: 19 AQREIQFRVINRVAVITLNRPAALNALSHAMIRELAVLVEHCRNDDSIVAIALKGAGHKG 78 Query: 79 FCAGGDIRALYDSFHAGTALHRQFFVDEYQLDYRLHCYPKPVVALMDGIVMGGGMGLAQA 138 FCAGGD+R ++ +G + FFVDEY+LDY LH +PKPVVA++DGI MGGGMGL QA Sbjct: 79 FCAGGDVREVHRLATSGDSRWLAFFVDEYRLDYALHTFPKPVVAILDGIAMGGGMGLGQA 138 Query: 139 AHLRVLTERSRVAMPETGIGLVPDVGASHFLSKLPLALALYVGLTGVTLGAADTLLCKLA 198 A LRV+TERS++AMPET IG +PDVGA+ FLS +P L LYVGLTG TL AD L +LA Sbjct: 139 ARLRVVTERSKIAMPETRIGFLPDVGATRFLSVMPAELELYVGLTGATLSGADALRLQLA 198 Query: 199 DIAVPAASLEHFEQTLAAINRTGDVLADLRAALQATPDAGEQAAPLQSVLPAVLRHFRAD 258 D VPA L EQ L ++ GD+L+ LR ++ + AA + + RHF Sbjct: 199 DQCVPADWLVSCEQRLQHMSHEGDLLSALRGVVEPPCNIVPHAA-ITPFTQLIQRHFDRR 257 Query: 259 ASVAGLLDSLA--AESDP--AYADWAARTLDILRGRSPLMMAVTRELLLRGRDLDLADCF 314 + V ++ +L E DP W T D L SP M+ VTRE LLRGR + LA+CF Sbjct: 258 SGVDRIMATLRHDLERDPPREVRQWLQSTYDALAAHSPTMLYVTREALLRGRQMTLAECF 317 Query: 315 RMELGVVSHAFSQGDFIEGVRALIVDKDNAPRWRVKDASEVSEAVVQSFFDSPWPREPHP 374 RMELG+V A +GDF EGVRA ++DKD RW +EV V+ F SPW +E HP Sbjct: 318 RMELGIVKRAIEEGDFCEGVRAQLIDKDRKGRWAPATLAEVRPERVRHFLSSPWKQEAHP 377 Query: 375 LAMLG 379 LA LG Sbjct: 378 LADLG 382 Lambda K H 0.322 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 386 Length adjustment: 30 Effective length of query: 354 Effective length of database: 356 Effective search space: 126024 Effective search space used: 126024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory