Align methylmalonyl-CoA epimerase (EC 5.1.99.1) (characterized)
to candidate H281DRAFT_04643 H281DRAFT_04643 methylmalonyl-CoA epimerase
Query= BRENDA::A4YEG2 (140 letters) >FitnessBrowser__Burk376:H281DRAFT_04643 Length = 128 Score = 56.2 bits (134), Expect = 2e-13 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 13/133 (9%) Query: 8 HVGVAVENLEEAIKLYTEKMGMKLVHREDLPDRGIKVAFL--TGNEGTTAVELMEPMNHE 65 H + V +L+ +I YTE +GMKL+ RED PD +AF+ T T +EL N + Sbjct: 5 HTMLRVGDLDRSIAFYTELLGMKLLRREDYPDGKFTLAFVGYTDERDGTVIELTH--NWD 62 Query: 66 DPNNTVAKFLKTRGQGMHHLAVKVKDINSSLRDLEGKGLTLIDKNGRKGARGHLVAFVHP 125 P + G G HLAV+V+D ++ ++ +G T++ + G ++AFV Sbjct: 63 TPAYDL-------GNGFGHLAVEVEDAYAACDKIKAQGGTVVREAGPMKHGTTVIAFVTD 115 Query: 126 KSVMGLLLELVQE 138 G +E +Q+ Sbjct: 116 PD--GYKIEFIQK 126 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 64 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 140 Length of database: 128 Length adjustment: 15 Effective length of query: 125 Effective length of database: 113 Effective search space: 14125 Effective search space used: 14125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory