GapMind for catabolism of small carbon sources

 

Alignments for a candidate for epi in Paraburkholderia bryophila 376MFSha3.1

Align methylmalonyl-CoA epimerase (EC 5.1.99.1) (characterized)
to candidate H281DRAFT_04643 H281DRAFT_04643 methylmalonyl-CoA epimerase

Query= BRENDA::A4YEG2
         (140 letters)



>FitnessBrowser__Burk376:H281DRAFT_04643
          Length = 128

 Score = 56.2 bits (134), Expect = 2e-13
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 13/133 (9%)

Query: 8   HVGVAVENLEEAIKLYTEKMGMKLVHREDLPDRGIKVAFL--TGNEGTTAVELMEPMNHE 65
           H  + V +L+ +I  YTE +GMKL+ RED PD    +AF+  T     T +EL    N +
Sbjct: 5   HTMLRVGDLDRSIAFYTELLGMKLLRREDYPDGKFTLAFVGYTDERDGTVIELTH--NWD 62

Query: 66  DPNNTVAKFLKTRGQGMHHLAVKVKDINSSLRDLEGKGLTLIDKNGRKGARGHLVAFVHP 125
            P   +       G G  HLAV+V+D  ++   ++ +G T++ + G       ++AFV  
Sbjct: 63  TPAYDL-------GNGFGHLAVEVEDAYAACDKIKAQGGTVVREAGPMKHGTTVIAFVTD 115

Query: 126 KSVMGLLLELVQE 138
               G  +E +Q+
Sbjct: 116 PD--GYKIEFIQK 126


Lambda     K      H
   0.316    0.135    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 64
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 140
Length of database: 128
Length adjustment: 15
Effective length of query: 125
Effective length of database: 113
Effective search space:    14125
Effective search space used:    14125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory