Align 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 (characterized)
to candidate H281DRAFT_02980 H281DRAFT_02980 Citrate synthase
Query= SwissProt::Q937N9 (385 letters) >FitnessBrowser__Burk376:H281DRAFT_02980 Length = 198 Score = 342 bits (878), Expect = 4e-99 Identities = 166/196 (84%), Positives = 181/196 (92%) Query: 189 SLNLYAEHEFNASTFTARVIAGTGSDMYSSISGAIGALRGPKHGGANEVAFEIQKRYDNP 248 SLNLYAEHEFNASTFT RVIAGTGSD+YS+I+GAIGALRGPKHGGANEVAFEIQ RY P Sbjct: 2 SLNLYAEHEFNASTFTGRVIAGTGSDIYSAITGAIGALRGPKHGGANEVAFEIQSRYQTP 61 Query: 249 DEAQADITRRVENKEVVIGFGHPVYTTGDPRNQVIKEVAKKLSKDAGSMKMFDIAEALET 308 DEA++DI RRVENKEVVIGFGHPVYT DPRN+VIKEVAKKLSK+AG+ K+FDIAE LE+ Sbjct: 62 DEAESDIRRRVENKEVVIGFGHPVYTISDPRNKVIKEVAKKLSKEAGNNKLFDIAERLES 121 Query: 309 VMWDIKKMFPNLDWFSAVSYHMMGVPTAMFTALFVIARTSGWAAHIIEQRIDNKIIRQSA 368 VMW+ KKMFPNLDWFSAVSYHMMGVPTAMFT LFVIART+GW+AHIIEQRIDNKIIR SA Sbjct: 122 VMWEAKKMFPNLDWFSAVSYHMMGVPTAMFTPLFVIARTAGWSAHIIEQRIDNKIIRPSA 181 Query: 369 NYTGPENLKFVPLKDR 384 NYTGP++L FVPL R Sbjct: 182 NYTGPDDLPFVPLAKR 197 Lambda K H 0.317 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 198 Length adjustment: 25 Effective length of query: 360 Effective length of database: 173 Effective search space: 62280 Effective search space used: 62280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory