Align 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 (characterized)
to candidate H281DRAFT_06327 H281DRAFT_06327 2-methylcitrate synthase
Query= SwissProt::O34002 (379 letters) >FitnessBrowser__Burk376:H281DRAFT_06327 Length = 272 Score = 173 bits (439), Expect = 4e-48 Identities = 99/226 (43%), Positives = 134/226 (59%), Gaps = 1/226 (0%) Query: 3 EPTIHKGLAGVTADVTAISKVNSDTNSLLYRGYPVQELAAKCSFEQVAYLLWNSELPNDS 62 +P L+GVTA TA+ V N L YRGY + ++A C FE++AYLL + +LP + Sbjct: 15 KPKKSVALSGVTAGNTALCTVGKTGNDLHYRGYDILDIAGNCEFEEIAYLLVHEKLPTQA 74 Query: 63 ELKAFVNFERSHRKLDENVKGAIDLLSTACHPMDVARTAVSVLGANHARAQDSSPEANLE 122 EL A+ ++ R L NVK A++ + A HPMDV RT VSVLG D + + Sbjct: 75 ELTAYKTKLKALRGLPANVKAALEWIPAAAHPMDVMRTGVSVLGTVLPEKDDHNLPGARD 134 Query: 123 KAMSLLATFPSVVAYDQRRRRGEELIEPREDLD-YSANFLWMTFGEEAAPEVVEAFNVSM 181 A L+A+ S++ Y + IE D D +FL + G E + V+A +VS+ Sbjct: 135 IADKLMASLGSMLLYWYHYSHNGKRIEVETDDDSIGGHFLHLLHGVEPSKSWVDAMHVSL 194 Query: 182 ILYAEHSFNASTFTARVITSTLADLHSAVTGAIGALKGPLHGGANE 227 LYAEH FNASTFT RVI T +D++SA+TGAIGAL+GP HGGANE Sbjct: 195 NLYAEHEFNASTFTGRVIAGTGSDIYSAITGAIGALRGPKHGGANE 240 Lambda K H 0.316 0.130 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 272 Length adjustment: 28 Effective length of query: 351 Effective length of database: 244 Effective search space: 85644 Effective search space used: 85644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory