Align Lmo2663 protein (characterized, see rationale)
to candidate H281DRAFT_03275 H281DRAFT_03275 Threonine dehydrogenase
Query= uniprot:Q8Y414 (343 letters) >FitnessBrowser__Burk376:H281DRAFT_03275 Length = 389 Score = 93.6 bits (231), Expect = 8e-24 Identities = 76/236 (32%), Positives = 113/236 (47%), Gaps = 26/236 (11%) Query: 31 IKVAFTGICGSDIHTFKGEYKNPTTPVTLGHEFSGVVVEVGPDVTSIKVGDRVTSETTFE 90 IKV+ ICGSD+H + G + +GHEF G V+EVG + +++KVGDRV T Sbjct: 30 IKVSSCAICGSDLHLYDGFMPGMESGDIMGHEFMGEVMEVGKENSALKVGDRVVVPFTI- 88 Query: 91 TCGECIYCKEHDYNLC--SNR------RGIGTQANGSF-------------AEFV-LSRE 128 CGEC CK ++++C SNR + G G F AEFV + Sbjct: 89 ICGECDQCKRGNFSVCERSNRNKDIADKMFGHTTAGLFGYTHLTGGYPGGQAEFVRVPFA 148 Query: 129 ESCHV-LDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLLAQVVKAQ 187 + HV + + +S E + A + I P DTV ++G GP+G + + Sbjct: 149 DKTHVKIPDGLSDEQVLFLGDIFPTGWQAAVQCDIEPTDTVAIWGAGPVGQMAIRSAVLL 208 Query: 188 GATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTGGYGAERVFDCSG 243 GA ++A I +RL +A+ G I D +E + E + +TGG G E+ D G Sbjct: 209 GAKQVIA-IDYVPERLSMARAGGAVTI-DFKEESVLERLKELTGGKGPEKCIDAVG 262 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 389 Length adjustment: 30 Effective length of query: 313 Effective length of database: 359 Effective search space: 112367 Effective search space used: 112367 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory